Comparing Ac3H11_609 FitnessBrowser__acidovorax_3H11:Ac3H11_609 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
44% identity, 99% coverage: 2:502/505 of query aligns to 4:492/501 of P04983
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 49% coverage: 2:250/505 of query aligns to 1:256/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
28% identity, 49% coverage: 2:250/505 of query aligns to 2:257/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
28% identity, 49% coverage: 2:250/505 of query aligns to 2:257/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
28% identity, 49% coverage: 2:250/505 of query aligns to 2:257/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 43% coverage: 2:220/505 of query aligns to 2:216/241 of 4u00A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 43% coverage: 2:219/505 of query aligns to 4:229/254 of 1g6hA
6qexA Nanodisc reconstituted human abcb1 in complex with uic2 fab and taxol (see paper)
34% identity, 43% coverage: 3:220/505 of query aligns to 361:577/1182 of 6qexA
Sites not aligning to the query:
7o9wA Encequidar-bound human p-glycoprotein in complex with uic2-fab (see paper)
34% identity, 43% coverage: 3:220/505 of query aligns to 348:564/1169 of 7o9wA
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 43% coverage: 2:220/505 of query aligns to 4:223/648 of P75831
7a6fA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and zosuquidar (see paper)
34% identity, 43% coverage: 3:220/505 of query aligns to 343:559/1164 of 7a6fA
Sites not aligning to the query:
7a6eA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and tariquidar (see paper)
34% identity, 43% coverage: 3:220/505 of query aligns to 343:559/1164 of 7a6eA
Sites not aligning to the query:
7a6cA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and elacridar (see paper)
34% identity, 43% coverage: 3:220/505 of query aligns to 343:559/1164 of 7a6cA
Sites not aligning to the query:
7a69A Nanodisc reconstituted human abcb1 in complex with mrk16 fab and vincristine (see paper)
34% identity, 43% coverage: 3:220/505 of query aligns to 343:559/1164 of 7a69A
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 43% coverage: 2:219/505 of query aligns to 4:229/253 of 1g9xB
6c0vA Molecular structure of human p-glycoprotein in the atp-bound, outward- facing conformation (see paper)
33% identity, 43% coverage: 3:220/505 of query aligns to 334:550/1154 of 6c0vA
Sites not aligning to the query:
6bppA E. Coli msba in complex with lps and inhibitor g092 (see paper)
32% identity, 43% coverage: 3:220/505 of query aligns to 339:555/576 of 6bppA
Sites not aligning to the query:
6bplA E. Coli msba in complex with lps and inhibitor g907 (see paper)
32% identity, 43% coverage: 3:220/505 of query aligns to 339:555/576 of 6bplA
Sites not aligning to the query:
P60752 ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA; Lipid flippase; EC 7.5.2.6 from Escherichia coli (strain K12) (see 7 papers)
32% identity, 43% coverage: 3:220/505 of query aligns to 342:558/582 of P60752
Sites not aligning to the query:
7ph3A Amp-pnp bound nanodisc reconstituted msba with nanobodies, spin- labeled at position a60c (see paper)
32% identity, 43% coverage: 3:220/505 of query aligns to 340:556/577 of 7ph3A
>Ac3H11_609 FitnessBrowser__acidovorax_3H11:Ac3H11_609
MLLEMRNIRKTFPGVVALNQVNLQVQAGEIHAIVGENGAGKSTLMKVLSGVYPHGSYSGQ
ILFDGQEREFAGIRDSEHLGIIIIHQELALVPLLSIAENIFLGNETARHGVIDWMAAHSR
AQALLHKVGLGESPDTPVGQLGVGKQQLVEIAKALSRKVRLLILDEPTASLNENDSQALL
DLLLELKAQGITCILISHKLNEISRVADAITVLRDGSTVQMLDCREGPVSEDRVIQAMVG
REMSDRYPQRQPQVGEIVFEVRNWRAHHPQRSDREHLKGIDLNVRRGEIVGIAGLMGAGR
TELAMSIFGRSWGQRISGEVRLHGQPIDVSTVEKAVSHGLAYVTEDRKGNGLVLNEDIQF
NTSLANLPGVSFASVIDSGQEHRVAQDYREKLRIRCSGVDQKTLNLSGGNQQKVVLSKWL
FTSPEVLILDEPTRGIDVGAKYEIYTLIAQLAAEGKCVIVISSEMPELLGITDRIYVMNE
GRFVAEMPTSEASQEKIMRAIVKAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory