Comparing Ac3H11_610 FitnessBrowser__acidovorax_3H11:Ac3H11_610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uugA Crystal structure of the periplasmic sugar binding protein chve (see paper)
79% identity, 92% coverage: 28:356/356 of query aligns to 1:329/329 of 3uugA
3urmA Crystal structure of the periplasmic sugar binding protein chve (see paper)
79% identity, 92% coverage: 28:356/356 of query aligns to 1:329/329 of 3urmA
4wwhA Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi- 510967) with bound d-galactose
67% identity, 92% coverage: 29:356/356 of query aligns to 2:329/329 of 4wwhA
4ys6A Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentans (cphy_1585, target efi- 511156) with bound beta-d-glucose
49% identity, 91% coverage: 32:356/356 of query aligns to 3:324/324 of 4ys6A
4rxuA Crystal structure of carbohydrate transporter solute binding protein caur_1924 from chloroflexus aurantiacus, target efi-511158, in complex with d-glucose
37% identity, 91% coverage: 31:353/356 of query aligns to 5:334/340 of 4rxuA
3ma0A Closed liganded crystal structure of xylose binding protein from escherichia coli (see paper)
38% identity, 91% coverage: 32:355/356 of query aligns to 5:307/313 of 3ma0A
4ywhA Crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose
37% identity, 91% coverage: 32:355/356 of query aligns to 6:308/310 of 4ywhA
6ruxA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
28% identity, 87% coverage: 31:339/356 of query aligns to 12:368/373 of 6ruxA
6s3tA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
28% identity, 87% coverage: 31:339/356 of query aligns to 14:370/374 of 6s3tA
8fxuA Thermoanaerobacter thermosaccharolyticum periplasmic glucose-binding protein glucose complex: badan conjugate attached at f17c (see paper)
27% identity, 67% coverage: 72:310/356 of query aligns to 45:279/310 of 8fxuA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
24% identity, 78% coverage: 32:309/356 of query aligns to 3:256/274 of 2ioyA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
23% identity, 63% coverage: 67:291/356 of query aligns to 44:246/287 of 4yo7A
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
23% identity, 79% coverage: 32:312/356 of query aligns to 5:271/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
23% identity, 79% coverage: 32:312/356 of query aligns to 5:271/297 of 4ry9A
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
24% identity, 78% coverage: 32:308/356 of query aligns to 5:258/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
24% identity, 78% coverage: 32:308/356 of query aligns to 5:258/287 of 4ry0A
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
25% identity, 70% coverage: 4:253/356 of query aligns to 9:239/349 of A0QYB5
Sites not aligning to the query:
4z0nA Crystal structure of a periplasmic solute binding protein (ipr025997) from streptobacillus moniliformis dsm-12112 (smon_0317, target efi- 511281) with bound d-galactose
24% identity, 74% coverage: 49:310/356 of query aligns to 21:277/307 of 4z0nA
Sites not aligning to the query:
3ga5A X-ray structure of glucose/galactose receptor from salmonella typhimurium in complex with (2r)-glyceryl-beta-d-galactopyranoside (see paper)
25% identity, 67% coverage: 69:308/356 of query aligns to 41:274/305 of 3ga5A
Sites not aligning to the query:
P23905 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
25% identity, 67% coverage: 69:308/356 of query aligns to 66:299/332 of P23905
Sites not aligning to the query:
>Ac3H11_610 FitnessBrowser__acidovorax_3H11:Ac3H11_610
MKRAIFKAVLASMALTAIGATSVASAQDKGAIGISMPTKSSARWIADGDNMVKVLKERGY
KTDLQYADDDIPNQLAQIENMITKGAKVLVIASIDGTTLSKALQNAADKGVKVIAYDRLI
KGSKNVDYYATFDNFQVGVLQATSIVDKLGLKQGKGPFNIELFGGSPDDNNAFFFYDGAM
SVLQPYIDSGKLVVRSKQTGMNKVGTLRWDGSVAQARMDNLLSAYYGKDKVHAVLSPYDG
ISIGILSSLKGVGYCTAQQPCPVVSGQDAEVPSIKSILKGEQSSTVFKDTRELAKVAANM
VDAVLTGKQPEINDTKTYNNGVKVVPSYLLKPVAVDSSNWNAVLVGSGYYKESQIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory