SitesBLAST
Comparing Ac3H11_614 FitnessBrowser__acidovorax_3H11:Ac3H11_614 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
65% identity, 90% coverage: 28:280/280 of query aligns to 3:254/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G43), T21 (≠ S46), I23 (= I48), D42 (= D67), I43 (≠ V68), C68 (= C93), D69 (= D94), L70 (≠ V95), N96 (= N122), A98 (= A124), F146 (≠ L172), S147 (≠ G173), S148 (= S174), Y161 (= Y187), K165 (= K191), P191 (= P217), G192 (= G218), W193 (= W219), V194 (= V220), R198 (= R224)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
49% identity, 90% coverage: 29:279/280 of query aligns to 9:257/258 of 5wjsA
- active site: G27 (= G47), S152 (= S174), Y162 (= Y184), Y165 (= Y187), K169 (= K191)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G43), T26 (≠ S46), I28 (= I48), D47 (= D67), L48 (≠ V68), D73 (= D94), L74 (≠ V95), N100 (= N122), A102 (= A124), L150 (= L172), G151 (= G173), S152 (= S174), K169 (= K191), P195 (= P217), G196 (= G218), W197 (= W219), V198 (= V220), K202 (≠ R224)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
32% identity, 88% coverage: 34:278/280 of query aligns to 3:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G43), Q15 (≠ S46), G16 (= G47), I17 (= I48), D36 (= D67), V63 (= V95), N89 (= N122), A91 (= A124), S94 (vs. gap), I142 (≠ L172), S143 (≠ G173), S144 (= S174), Y157 (= Y187), K161 (= K191), P187 (= P217), H188 (≠ G218), I190 (≠ V220), I194 (≠ R224)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
37% identity, 88% coverage: 33:279/280 of query aligns to 2:245/247 of 6j7uA
- active site: G16 (= G47), S142 (= S174), Y156 (= Y187)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G43), S14 (≠ G45), R15 (≠ S46), I17 (= I48), Y36 (≠ D67), V37 (= V68), S38 (vs. gap), S41 (≠ A69), D65 (= D94), S66 (≠ V95), N92 (= N122), A93 (≠ V123), G94 (≠ A124), I115 (= I145), G141 (= G173), S142 (= S174), Y156 (= Y187), K160 (= K191), P186 (= P217), T191 (= T222), M193 (≠ R224), N194 (≠ Q225)
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
34% identity, 88% coverage: 34:280/280 of query aligns to 3:245/247 of 2ewmB
- active site: G16 (= G47), S139 (= S174), Y149 (= Y184), Y152 (= Y187), K156 (= K191)
- binding nicotinamide-adenine-dinucleotide: G12 (= G43), N15 (≠ S46), G16 (= G47), I17 (= I48), D36 (= D67), L37 (≠ V68), C59 (= C93), D60 (= D94), V61 (= V95), N87 (= N122), S139 (= S174), Y152 (= Y187), K156 (= K191), P182 (= P217), S183 (≠ G218), L184 (≠ W219), V185 (= V220), T189 (≠ R224)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
34% identity, 88% coverage: 34:280/280 of query aligns to 5:247/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
34% identity, 86% coverage: 37:278/280 of query aligns to 14:262/267 of Q9LBG2
- 17:42 (vs. 40:65, 42% identical) binding
- E103 (≠ S125) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
34% identity, 86% coverage: 37:278/280 of query aligns to 5:253/258 of 1iy8A
- active site: G15 (= G47), S143 (= S174), Q153 (≠ P185), Y156 (= Y187), K160 (= K191)
- binding nicotinamide-adenine-dinucleotide: G11 (= G43), S14 (= S46), G15 (= G47), L16 (≠ I48), D35 (= D67), V36 (= V68), A62 (≠ C93), D63 (= D94), V64 (= V95), N90 (= N121), G92 (≠ V123), I93 (≠ A124), T141 (≠ L172), S143 (= S174), Y156 (= Y187), K160 (= K191), P186 (= P217), G187 (= G218), T191 (vs. gap), P192 (vs. gap), M193 (= M221)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
30% identity, 90% coverage: 29:279/280 of query aligns to 1:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G43), S17 (≠ G45), R18 (≠ S46), I20 (= I48), T40 (≠ V68), N62 (≠ D94), V63 (= V95), N89 (= N122), A90 (≠ V123), I92 (≠ S125), V139 (≠ L172), S141 (= S174), Y154 (= Y187), K158 (= K191), P184 (= P217), G185 (= G218), I187 (≠ V220), T189 (= T222), M191 (≠ Q225)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
30% identity, 89% coverage: 33:280/280 of query aligns to 1:253/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G43), T13 (≠ G45), S14 (= S46), G15 (= G47), I16 (= I48), G35 (≠ A64), F36 (= F65), L60 (≠ V95), N86 (= N122), G88 (≠ A124), I89 (≠ S125), A137 (≠ G173), Y151 (= Y187), K155 (= K191), P181 (= P217), G182 (= G218), V184 (= V220), T186 (= T222)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
29% identity, 91% coverage: 24:278/280 of query aligns to 20:273/278 of Q9BTZ2
- S176 (≠ G181) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ Y184) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ G200) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
33% identity, 88% coverage: 34:279/280 of query aligns to 3:243/245 of 5wuwA
- active site: G16 (= G47), S140 (= S174), Y154 (= Y187), L161 (≠ V194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G43), R15 (≠ S46), I17 (= I48), Y36 (≠ D67), A37 (≠ V68), A38 (= A69), D63 (= D94), S64 (≠ V95), N90 (= N122), A91 (≠ V123), G92 (≠ A124), Y154 (= Y187), K158 (= K191), G185 (= G218), P186 (≠ W219), V187 (= V220)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
31% identity, 88% coverage: 34:278/280 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G43), M16 (≠ I48), D35 (= D67), I36 (≠ V68), I62 (≠ V95), N88 (= N122), G90 (≠ A124), I138 (≠ L172), S140 (= S174), Y152 (= Y187), K156 (= K191), I185 (≠ V220)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
31% identity, 88% coverage: 34:278/280 of query aligns to 3:242/248 of Q9KJF1
- S15 (= S46) binding
- D36 (= D67) binding
- D62 (= D94) binding
- I63 (≠ V95) binding
- N89 (= N122) binding
- Y153 (= Y187) binding
- K157 (= K191) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
29% identity, 90% coverage: 29:279/280 of query aligns to 1:240/243 of 4i08A
- active site: G19 (= G47), N113 (= N146), S141 (= S174), Q151 (≠ Y184), Y154 (= Y187), K158 (= K191)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G43), S17 (≠ G45), R18 (≠ S46), I20 (= I48), T40 (≠ V68), N62 (≠ D94), V63 (= V95), N89 (= N122), A90 (≠ V123), G140 (= G173), S141 (= S174), Y154 (= Y187), K158 (= K191), P184 (= P217), G185 (= G218), T189 (= T222)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
30% identity, 88% coverage: 33:278/280 of query aligns to 2:236/239 of 4nbtA
- active site: G16 (= G47), S132 (= S174), Y145 (= Y187), K149 (= K191)
- binding nicotinamide-adenine-dinucleotide: G12 (= G43), K15 (≠ S46), G16 (= G47), L17 (≠ I48), D36 (≠ E71), L37 (≠ A72), L52 (≠ W90), N53 (≠ R91), V54 (= V92), N80 (= N122), A81 (≠ V123), G82 (≠ A124), I130 (≠ L172), S132 (= S174), Y145 (= Y187), K149 (= K191), P177 (= P217), G178 (= G218), I180 (≠ V220), T182 (= T222)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
32% identity, 89% coverage: 31:279/280 of query aligns to 2:251/254 of 4fn4A
- active site: G18 (= G47), S144 (= S174), Y157 (= Y187), K161 (= K191), S202 (≠ A232)
- binding nicotinamide-adenine-dinucleotide: G14 (= G43), S17 (= S46), G18 (= G47), I19 (= I48), E38 (≠ D67), L39 (≠ V68), R43 (≠ A72), A63 (vs. gap), D64 (vs. gap), V65 (= V92), N91 (= N122), G93 (≠ A124), I94 (≠ S125), T142 (≠ L172), S144 (= S174), Y157 (= Y187), K161 (= K191), P187 (= P217), V190 (= V220), T192 (= T222), N193 (≠ E223), I194 (≠ R224)
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
33% identity, 88% coverage: 34:279/280 of query aligns to 3:241/253 of 2hsdA
- active site: G16 (= G47), S138 (= S174), Y151 (= Y187), K155 (= K191)
- binding nicotinamide-adenine-dinucleotide: G12 (= G43), R15 (≠ S46), G16 (= G47), L17 (≠ I48), D36 (= D67), V37 (= V68), L58 (≠ C93), V60 (= V95), N86 (= N122), A87 (≠ V123), S138 (= S174), Y151 (= Y187), K155 (= K191), P181 (= P217), G182 (= G218), T184 (≠ V220)
1hdcA Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor (see paper)
33% identity, 88% coverage: 34:279/280 of query aligns to 3:241/253 of 1hdcA
- active site: G16 (= G47), S138 (= S174), Y151 (= Y187), K155 (= K191)
- binding carbenoxolone: S90 (≠ D126), T91 (≠ D127), G92 (≠ R128), L147 (≠ T182), Y151 (= Y187), M183 (≠ W219), M188 (≠ R224), T189 (≠ Q225), T192 (≠ L228)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
29% identity, 88% coverage: 34:280/280 of query aligns to 3:242/244 of 7krmC
- active site: G18 (= G47), S140 (= S174), Y155 (= Y187)
- binding nicotinamide-adenine-dinucleotide: G12 (= G43), S15 (= S46), G18 (= G47), I19 (= I48), D38 (= D67), L39 (≠ V68), A60 (≠ C93), N61 (≠ D94), V62 (= V95), N88 (= N122), V111 (≠ I145), S140 (= S174), Y155 (= Y187), K159 (= K191), I188 (≠ V220), T190 (= T222)
Query Sequence
>Ac3H11_614 FitnessBrowser__acidovorax_3H11:Ac3H11_614
LIDCNIDMTQLFAPSSSSTDATGAPQGLAKFPSLQGRAVFVTGGGSGIGAAIVAAFAEQG
ARVAFVDVAREASEALAQHIADAGLPRPWWRVCDVRDVQALQACMADAAAELGSDFAVLV
NNVASDDRHTLESVTPEYYDERMAINERPAFFAIQAVVPGMRRLGAGSVINLGSTGWQGK
GTGYPCYAIAKSSVNGLTRGLAKTLGQDRIRINTVSPGWVMTERQIKLWLDAEGEKELAR
NQCLPDKLRPHDIARMVLFLASDDAAMCTAQEFKVDAGWV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory