Comparing Ac3H11_650 FitnessBrowser__acidovorax_3H11:Ac3H11_650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
2iiiA Crystal structure of the adenosylmethionine decarboxylase (aq_254) from aquifex aeolicus vf5
34% identity, 96% coverage: 3:126/129 of query aligns to 5:116/120 of 2iiiA
Q57763 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
29% identity, 95% coverage: 3:125/129 of query aligns to 6:117/124 of Q57763
O34426 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Bacillus subtilis (strain 168) (see paper)
31% identity, 74% coverage: 3:98/129 of query aligns to 5:98/126 of O34426
Q9UWU1 Arginine decarboxylase proenzyme; ADC; ArgDC; Pyruvoyl-dependent arginine decarboxylase; EC 4.1.1.19 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
36% identity, 75% coverage: 20:116/129 of query aligns to 37:131/134 of Q9UWU1
Q9WZC3 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 81% coverage: 3:107/129 of query aligns to 5:102/130 of Q9WZC3
Q9UWY8 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
52% identity, 24% coverage: 58:88/129 of query aligns to 61:91/124 of Q9UWY8
>Ac3H11_650 FitnessBrowser__acidovorax_3H11:Ac3H11_650
MQGLHLTADLQGCRCASAWLLDATALGGACTDAVRAAGLQAVGQLFYEFPATARGPGGVT
ATVLLAESHLCVHTWPEQRAVTLDVYVCNFGADHSAKAHALMDALLALFQPTTADRHALQ
RGVVSEVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory