Comparing Ac3H11_671 FitnessBrowser__acidovorax_3H11:Ac3H11_671 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
5uhsA Structure of a semisweet d57a mutant (see paper)
47% identity, 88% coverage: 3:80/89 of query aligns to 1:78/81 of 5uhsA
B0SR19 Sugar transporter SemiSWEET from Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) (see paper)
45% identity, 92% coverage: 3:84/89 of query aligns to 1:82/85 of B0SR19
P0DMV3 Sugar transporter SemiSWEET from Escherichia coli (strain UMEA 3162-1) (see paper)
42% identity, 64% coverage: 21:77/89 of query aligns to 21:77/89 of P0DMV3
Sites not aligning to the query:
>Ac3H11_671 FitnessBrowser__acidovorax_3H11:Ac3H11_671
MQLPELIGYLAATLTTCSFVPQALQTFRTRDVSGISLGMYSVFTAGVALWLVYGLALAAW
PIVVANAITLALAGTILGMKVRYGVRGAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory