Comparing Ac3H11_695 FitnessBrowser__acidovorax_3H11:Ac3H11_695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
35% identity, 95% coverage: 12:350/355 of query aligns to 5:324/326 of Q8RDH4
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
34% identity, 88% coverage: 10:323/355 of query aligns to 2:305/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 89% coverage: 12:328/355 of query aligns to 4:292/310 of 4fwiB
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 74% coverage: 10:271/355 of query aligns to 2:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 74% coverage: 10:271/355 of query aligns to 2:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 74% coverage: 10:271/355 of query aligns to 2:247/250 of 7z16I
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 73% coverage: 12:269/355 of query aligns to 4:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 73% coverage: 12:269/355 of query aligns to 4:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 73% coverage: 12:269/355 of query aligns to 4:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 73% coverage: 12:269/355 of query aligns to 4:239/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 73% coverage: 10:268/355 of query aligns to 1:236/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 72% coverage: 12:268/355 of query aligns to 2:241/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 72% coverage: 12:268/355 of query aligns to 3:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 72% coverage: 12:268/355 of query aligns to 3:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 72% coverage: 12:268/355 of query aligns to 3:242/344 of 3tuiC
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 71% coverage: 21:271/355 of query aligns to 3:239/240 of 4ymuJ
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
27% identity, 82% coverage: 11:302/355 of query aligns to 3:269/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
27% identity, 82% coverage: 11:302/355 of query aligns to 3:269/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
27% identity, 82% coverage: 11:302/355 of query aligns to 3:269/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
27% identity, 82% coverage: 11:302/355 of query aligns to 3:269/353 of Q97UY8
>Ac3H11_695 FitnessBrowser__acidovorax_3H11:Ac3H11_695
MTSPTMSAAPRLEVSGLSTSFATDAGRIQSVADVSFAIYPGETLALVGESGSGKSVTSLT
LMGLHARTSQAQVTGQAWFVQRDGRKVDLLAMPEAEKRTLRGNELAMIFQEPMTSLNPVL
TVGEQIAESARLHLKMDRSTALAHARRMLELVEIPAAAQRVHEYPHQLSGGMRQRVMIAL
AMACNPTLLIADEPTTALDVTIQAQILALMGRLQKETGMSMLFVTHNLGVVAQYADAVAV
MYAGRIVESARVHDLFARPEHPYTRGLLACLPGVARRQAQATDHAIAAGRRKLVAIPGQV
SSPLAPPPGCAFAPRCTRQQADCTHAMPALEATGPRRMVRCLHREEHAEPAEVSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory