SitesBLAST
Comparing Ac3H11_700 2-dehydro-3-deoxygluconate kinase (EC 2.7.1.45) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
31% identity, 97% coverage: 11:319/319 of query aligns to 3:305/308 of 2dcnA
- active site: G252 (= G266), A253 (= A267), G254 (= G268), D255 (= D269)
- binding adenosine-5'-diphosphate: D193 (≠ G203), K223 (= K234), G225 (= G236), P226 (≠ A237), G228 (= G239), V247 (≠ L261), G254 (= G268), I279 (≠ N293), S282 (≠ A296), V286 (= V300)
- binding 6-O-phosphono-beta-D-psicofuranosonic acid: G33 (= G37), F89 (≠ Y93), Y105 (= Y106), R107 (= R108), I136 (= I144), R165 (= R177), T251 (= T265), G252 (= G266), D255 (= D269), D291 (≠ A305)
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
28% identity, 97% coverage: 10:319/319 of query aligns to 2:307/311 of 2varA
- active site: G254 (= G266), A255 (= A267), G256 (= G268), D257 (= D269)
- binding adenosine monophosphate: G227 (= G236), G230 (= G239), M259 (≠ F271), S284 (≠ A296), I288 (≠ V300)
- binding phosphoaminophosphonic acid-adenylate ester: K225 (= K234), G227 (= G236), S228 (≠ A237), G230 (= G239), G254 (= G266), A255 (= A267), G256 (= G268), D257 (= D269), M259 (≠ F271), I281 (≠ N293), S284 (≠ A296), I288 (≠ V300)
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: L10 (= L18), G33 (= G37), S34 (≠ D38), Y89 (= Y93), Y105 (= Y106), R107 (= R108), I136 (= I144), R165 (= R177), G254 (= G266), D257 (= D269)
- binding 2-keto-3-deoxygluconate: G33 (= G37), S34 (≠ D38), Y89 (= Y93), L103 (≠ F104), Y105 (= Y106), R107 (= R108), I136 (= I144), R165 (= R177), T253 (= T265), G254 (= G266), D257 (= D269), D293 (≠ A305)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
28% identity, 97% coverage: 10:319/319 of query aligns to 3:308/313 of Q97U29
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
31% identity, 92% coverage: 27:319/319 of query aligns to 22:309/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (≠ L201), T221 (≠ K234), G223 (= G236), A242 (≠ S258), V243 (= V259), F255 (= F271), N283 (= N293), G286 (≠ A296), A287 (≠ S297)
- binding beta-D-fructofuranose: G32 (= G37), A33 (≠ D38), F100 (= F104), F102 (≠ Y106), R163 (= R177), D253 (= D269)
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
31% identity, 92% coverage: 27:319/319 of query aligns to 18:305/306 of 5eynA
- active site: G246 (= G266), A247 (= A267), G248 (= G268), D249 (= D269)
- binding adenosine-5'-diphosphate: H91 (≠ A100), T217 (≠ K234), G219 (= G236), A220 (= A237), A238 (≠ S258), V239 (= V259), T244 (≠ A264), G246 (= G266), A247 (= A267), G248 (= G268), F251 (= F271), N279 (= N293), G282 (≠ A296), A283 (≠ S297)
- binding beryllium trifluoride ion: G246 (= G266), G248 (= G268), D249 (= D269)
- binding beta-D-fructofuranose: G28 (= G37), A29 (≠ D38), N32 (= N41), F96 (= F104), F98 (≠ Y106), R159 (= R177), D249 (= D269)
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
28% identity, 97% coverage: 11:319/319 of query aligns to 4:305/308 of 3iq0B
- active site: G252 (= G266), A253 (= A267), G254 (= G268), D255 (= D269)
- binding adenosine-5'-triphosphate: S192 (≠ G203), K223 (= K234), G225 (= G236), E247 (≠ L261), A253 (= A267), G254 (= G268), F257 (= F271), N279 (= N293), G282 (≠ A296)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 89% coverage: 10:293/319 of query aligns to 3:275/309 of Q53W83
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
32% identity, 97% coverage: 10:319/319 of query aligns to 3:301/301 of 1v1aA
- active site: G248 (= G266), A249 (= A267), G250 (= G268), D251 (= D269)
- binding adenosine-5'-diphosphate: K219 (= K234), G221 (= G236), A222 (= A237), A249 (= A267), G250 (= G268), N275 (= N293), A279 (≠ S297)
- binding 2-keto-3-deoxygluconate: L11 (= L18), G34 (= G37), A35 (≠ D38), N38 (= N41), Y89 (= Y93), R105 (= R108), R167 (= R177), G248 (= G266), D251 (= D269), D287 (≠ A305)
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
34% identity, 89% coverage: 10:293/319 of query aligns to 3:275/300 of 1v1bA
- active site: G248 (= G266), A249 (= A267), G250 (= G268), D251 (= D269)
- binding adenosine-5'-triphosphate: K219 (= K234), G221 (= G236), A238 (≠ S258), F239 (≠ V259), V241 (≠ L261), G248 (= G266), A249 (= A267), G250 (= G268), N275 (= N293)
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 98% coverage: 6:319/319 of query aligns to 2:307/319 of Q8ZKR2
- D16 (≠ E20) binding
- G31 (= G37) binding
- Y101 (= Y106) binding
- R162 (= R177) binding
- A180 (≠ V194) binding
- A181 (≠ S195) binding
- A183 (≠ C197) binding
- G213 (= G227) binding
- D246 (= D263) binding
- T248 (= T265) binding
- D252 (= D269) binding
- A287 (= A299) binding
- A290 (≠ G302) binding
- G292 (= G304) binding
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
29% identity, 98% coverage: 6:319/319 of query aligns to 1:296/299 of 1tz3A
- active site: C24 (≠ G34), F88 (= F104), G238 (= G266), A239 (= A267), G240 (= G268), D241 (= D269)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E16), S10 (≠ L18), D12 (≠ E20), G27 (= G37), L83 (≠ Y93), F88 (= F104), Y90 (= Y106), R151 (= R177), M154 (≠ L180), D241 (= D269)
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
29% identity, 98% coverage: 6:319/319 of query aligns to 1:296/297 of 1tz6A
- active site: C24 (≠ G34), F88 (= F104), G238 (= G266), A239 (= A267), G240 (= G268), D241 (= D269)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N175), K176 (≠ L201), E181 (≠ D206), S209 (≠ K234), G211 (= G236), A212 (= A237), G214 (= G239), A239 (= A267), G240 (= G268), F243 (= F271), N270 (= N293), G273 (≠ A296), A274 (≠ S297)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E16), D12 (≠ E20), G27 (= G37), F88 (= F104), Y90 (= Y106), R151 (= R177), M154 (≠ L180), D241 (= D269)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
29% identity, 92% coverage: 25:319/319 of query aligns to 23:302/306 of 4xckA
- active site: A249 (≠ G266), A250 (= A267), G251 (= G268), D252 (= D269)
- binding adenosine-5'-diphosphate: T220 (≠ K234), G222 (= G236), S223 (≠ A237), V242 (= V259), T247 (≠ A264), A250 (= A267), F254 (= F271), H276 (≠ N293), A279 (= A296), V283 (= V300)
- binding alpha-D-ribofuranose: G39 (= G37), K40 (≠ D38), N43 (= N41), A95 (≠ Y93), I107 (≠ S105), I109 (≠ L107), E140 (≠ A150), T248 (= T265), D252 (= D269)
Sites not aligning to the query:
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
32% identity, 94% coverage: 6:306/319 of query aligns to 12:303/306 of 4ebuA
- active site: A263 (≠ G266), A264 (= A267), G265 (= G268), D266 (= D269)
- binding adenosine-5'-diphosphate: S202 (≠ G203), K233 (= K234), G235 (= G236), V255 (≠ S258), A264 (= A267), G265 (= G268), F268 (= F271), A293 (= A296)
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
28% identity, 97% coverage: 9:319/319 of query aligns to 2:308/312 of 3in1A
- active site: R106 (≠ H102), G255 (= G266), A256 (= A267), G257 (= G268), D258 (= D269)
- binding adenosine-5'-diphosphate: N194 (≠ G203), K225 (= K234), G227 (= G236), G230 (= G239), A244 (≠ R253), T253 (≠ A264), N282 (= N293), A285 (= A296)
8cqxA Ribokinase from t.Sp mutant a92g
32% identity, 92% coverage: 25:319/319 of query aligns to 21:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ G203), T217 (≠ K234), G219 (= G236), A220 (= A237), G222 (= G239), F250 (= F271), N272 (= N293), G275 (≠ A296), A276 (≠ S297), T279 (≠ V300)
- binding magnesium ion: D242 (= D263), T244 (= T265), A278 (= A299), S287 (≠ P308)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
27% identity, 95% coverage: 8:310/319 of query aligns to 12:299/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (≠ G203), T222 (≠ K234), G224 (= G236), A225 (= A237), G227 (= G239), T243 (≠ G256), V246 (= V259), A254 (= A267), G255 (= G268), N282 (= N293), A285 (= A296), A286 (≠ S297), V289 (= V300)
- binding alpha-D-ribofuranose: D14 (= D10), G40 (= G37), K41 (≠ D38), N44 (= N41), A96 (≠ Y93), E141 (≠ A147), D256 (= D269)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
27% identity, 95% coverage: 8:310/319 of query aligns to 12:299/317 of 5c41A
- active site: G253 (= G266), A254 (= A267), G255 (= G268), D256 (= D269)
- binding phosphomethylphosphonic acid adenylate ester: N186 (≠ G203), T222 (≠ K234), G224 (= G236), A225 (= A237), G227 (= G239), V246 (= V259), G255 (= G268), N282 (= N293), A285 (= A296), A286 (≠ S297)
5c3yA Structure of human ribokinase crystallized with amppnp
27% identity, 95% coverage: 8:310/319 of query aligns to 11:298/306 of 5c3yA
- active site: G252 (= G266), A253 (= A267), G254 (= G268), D255 (= D269)
- binding amp phosphoramidate: T221 (≠ K234), G223 (= G236), V245 (= V259), T250 (≠ A264), G254 (= G268), N281 (= N293), A284 (= A296), A285 (≠ S297)
6wjzA Crystal structure of human ribokinase in complex with ampcp
27% identity, 95% coverage: 8:310/319 of query aligns to 12:299/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (≠ G203), T222 (≠ K234), G224 (= G236), A225 (= A237), G227 (= G239), T243 (≠ G256), V246 (= V259), A254 (= A267), G255 (= G268), N282 (= N293), A285 (= A296), A286 (≠ S297), V289 (= V300)
Query Sequence
>Ac3H11_700 2-dehydro-3-deoxygluconate kinase (EC 2.7.1.45)
MTATKQAVWDVVALGEALVEFNQTRPGEPQYLQGFGGDTSNAVIAAARAGARTAYLTRLG
SDAFGQALLDLWAREGVDTTAVERDAQHPTGIYFVTHGAAGHEFSYLRAGSAASRMAPAW
LADESVKGPAAVLQQCRILHVSGISLAVSASACDTAYEAMRVARAAGARVAFDPNLRLKL
WPLARARACIAHAVSLCDIFLPGLDDMAALLGLSDADAIADWGHAQGAATVVVKLGADGV
LLSSADPAVPRQRVPGRSVALVDATGAGDCFDGNLLARLALGDDLAAAVRYANTAASLAV
QGFGAVAPLPTAQQVQALL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory