Comparing Ac3H11_704 FitnessBrowser__acidovorax_3H11:Ac3H11_704 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
39% identity, 95% coverage: 16:421/426 of query aligns to 8:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
39% identity, 95% coverage: 16:421/426 of query aligns to 8:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
31% identity, 97% coverage: 5:419/426 of query aligns to 3:408/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
22% identity, 88% coverage: 35:407/426 of query aligns to 25:426/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
22% identity, 88% coverage: 35:407/426 of query aligns to 24:425/455 of 5j7iC
4itbA Structure of bacterial enzyme in complex with cofactor and substrate (see paper)
25% identity, 61% coverage: 138:396/426 of query aligns to 140:439/453 of 4itbA
Sites not aligning to the query:
6gvsA Engineered glycolyl-coa reductase comprising 8 mutations with bound NADP+ (see paper)
26% identity, 70% coverage: 119:415/426 of query aligns to 104:424/441 of 6gvsA
4yweA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
23% identity, 74% coverage: 109:422/426 of query aligns to 126:476/476 of 4yweA
Sites not aligning to the query:
5jfmA Crystal structure of rhodopseudomonas palustris propionaldehyde dehydrogenase with bound propionyl-coa (see paper)
25% identity, 70% coverage: 119:415/426 of query aligns to 102:422/439 of 5jfmA
5jflA Crystal structure of rhodopseudomonas palustris propionaldehyde dehydrogenase with bound NAD+ (see paper)
25% identity, 70% coverage: 119:415/426 of query aligns to 103:423/440 of 5jflA
5jfmB Crystal structure of rhodopseudomonas palustris propionaldehyde dehydrogenase with bound propionyl-coa (see paper)
25% identity, 70% coverage: 119:415/426 of query aligns to 115:435/452 of 5jfmB
7bvpA Adhe spirosome in extended conformation (see paper)
29% identity, 35% coverage: 119:265/426 of query aligns to 103:249/869 of 7bvpA
Sites not aligning to the query:
6tqmA Escherichia coli adhe structure in its compact conformation (see paper)
29% identity, 35% coverage: 119:265/426 of query aligns to 103:249/869 of 6tqmA
Sites not aligning to the query:
P0A9Q7 Bifunctional aldehyde-alcohol dehydrogenase AdhE; Alcohol dehydrogenase E; EC 1.2.1.10; EC 1.1.1.1 from Escherichia coli (strain K12) (see 8 papers)
29% identity, 35% coverage: 119:265/426 of query aligns to 103:249/891 of P0A9Q7
Sites not aligning to the query:
P0A9Q8 Bifunctional aldehyde-alcohol dehydrogenase AdhE; Alcohol dehydrogenase E; EC 1.2.1.10; EC 1.1.1.1 from Escherichia coli O157:H7 (see paper)
29% identity, 35% coverage: 119:265/426 of query aligns to 103:249/891 of P0A9Q8
Sites not aligning to the query:
3vz3A Structural insights into substrate and cofactor selection by sp2771 (see paper)
25% identity, 61% coverage: 138:396/426 of query aligns to 140:439/453 of 3vz3A
Sites not aligning to the query:
>Ac3H11_704 FitnessBrowser__acidovorax_3H11:Ac3H11_704
MNALHVAEYTHSLGLQAKTASALMAKAPAAIKNKALKALARLLRENVDALQIDNARDLER
ARAAGLAEPMVDRLKLSPKVLETCAEGCEQLAAMPDIIGEILGMKQQPSGIRVGQMRVPI
GVFGMIYESRPNVTIEAASLSIKSGNACILRGGSEAIDSNKALAKLVQQALAEAGLPQDA
VQLVQTTDREAVGQLIAMPQFVDVIIPRGGKGLIERISRDAKVPVIKHLDGNCHTYVDDP
CDVPMAVKVADNAKTNKYSPCNASEGLLVARGVAAEFLPKIGAVYAAKGVEMRGCPESLA
ILQSVAGAQLVPATEQDWSEEYLAPIISVKIVAGLDEAIAHINHYSSHHTDAILTTNHVH
AQRFLREVDSASVMVNASTRFADGFEYGLGAEIGISTDKFHARGPVGIEGLTSLKYVVLG
EGEVRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory