Comparing Ac3H11_745 FitnessBrowser__acidovorax_3H11:Ac3H11_745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
34% identity, 60% coverage: 1:183/307 of query aligns to 19:190/339 of 6cgqA
Sites not aligning to the query:
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
29% identity, 100% coverage: 1:306/307 of query aligns to 22:323/350 of 2zsjA
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
32% identity, 100% coverage: 1:306/307 of query aligns to 22:323/350 of 1uimA
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
32% identity, 100% coverage: 1:306/307 of query aligns to 21:322/350 of 3aeyA
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
32% identity, 100% coverage: 1:306/307 of query aligns to 22:323/351 of 3aexA
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
32% identity, 100% coverage: 1:306/307 of query aligns to 22:323/351 of 1v7cA
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
34% identity, 60% coverage: 1:183/307 of query aligns to 23:200/350 of 6nmxA
Sites not aligning to the query:
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
34% identity, 60% coverage: 1:183/307 of query aligns to 21:198/345 of 6cgqB
Sites not aligning to the query:
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
25% identity, 99% coverage: 1:303/307 of query aligns to 89:400/444 of 2c2bA
Sites not aligning to the query:
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 99% coverage: 1:303/307 of query aligns to 164:475/526 of Q9S7B5
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
25% identity, 99% coverage: 1:303/307 of query aligns to 107:402/448 of 2c2gA
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
28% identity, 100% coverage: 1:306/307 of query aligns to 32:332/360 of A0R220
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
28% identity, 100% coverage: 1:306/307 of query aligns to 32:332/360 of P9WG59
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
28% identity, 100% coverage: 1:306/307 of query aligns to 23:323/349 of 2d1fA
3pc4A Full length structure of cystathionine beta-synthase from drosophila in complex with serine (see paper)
28% identity, 48% coverage: 6:152/307 of query aligns to 48:204/504 of 3pc4A
Sites not aligning to the query:
3pc3A Full length structure of cystathionine beta-synthase from drosophila in complex with aminoacrylate (see paper)
28% identity, 48% coverage: 6:152/307 of query aligns to 48:204/504 of 3pc3A
Sites not aligning to the query:
3pc2A Full length structure of cystathionine beta-synthase from drosophila (see paper)
28% identity, 48% coverage: 6:152/307 of query aligns to 46:202/500 of 3pc2A
Sites not aligning to the query:
7mfjBBB Beta-cyanoalanine synthase (see paper)
31% identity, 43% coverage: 6:136/307 of query aligns to 22:166/319 of 7mfjBBB
Sites not aligning to the query:
6xo2A Structural characterization of beta cyanoalanine synthase from tetranychus urticae (two-spotted spider mite) (see paper)
31% identity, 43% coverage: 6:136/307 of query aligns to 23:167/294 of 6xo2A
Sites not aligning to the query:
6c2zA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the plp-aminoacrylate intermediate (see paper)
30% identity, 42% coverage: 6:133/307 of query aligns to 16:156/345 of 6c2zA
Sites not aligning to the query:
>Ac3H11_745 FitnessBrowser__acidovorax_3H11:Ac3H11_745
VSLGEGNTPCLGLPRLAQRLGIRQLSAKHEGLNPTGSHKDRMSAQAVARALAVDAHKVVL
ASSGNAAVSAAAYCAAAGLPCEVATYRDMPAPFARALDRLGARRVAFDQGPDRWAHVRRQ
VEEEGAFALTNFSVPAVGSPAFGVEGYRAVALECVAEGCVPDHVIVPTARGDLLWGMYSA
LRDLLAAGLIARMPRLWAVEPFARLSQVLAGAPAQADFGGSTAQFSIAGSTVTLQQQIAV
QRSGGGAVVVGDADAARGVAELGAQGLWVELCAGACVGAAAQLCQHGHIAPQDHVLLLLT
AKGDRDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory