SitesBLAST
Comparing Ac3H11_779 FitnessBrowser__acidovorax_3H11:Ac3H11_779 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 98% coverage: 2:314/318 of query aligns to 12:322/339 of P9WID3
- K283 (≠ E275) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
40% identity, 95% coverage: 4:304/318 of query aligns to 4:303/309 of 3uqdB
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding adenosine-5'-diphosphate: K185 (= K185), N187 (≠ S187), S224 (= S224), G226 (= G226), P227 (≠ E227), G229 (= G229), S248 (≠ T249), M258 (≠ F259), V280 (= V281), G283 (= G284), S284 (≠ A285)
- binding adenosine-5'-triphosphate: Y23 (≠ A23), K27 (= K27)
- binding 6-O-phosphono-beta-D-fructofuranose: K27 (= K27), R29 (= R29)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: D14 (= D14), G39 (= G39), N43 (= N43), R90 (= R90), R105 (= R105), S139 (= S140), G253 (= G254)
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
40% identity, 95% coverage: 4:304/318 of query aligns to 4:303/309 of 3uqdA
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding adenosine-5'-triphosphate: K185 (= K185), S224 (= S224), G226 (= G226), P227 (≠ E227), G229 (= G229), T251 (= T252), G255 (= G256), M258 (≠ F259), V280 (= V281), G283 (= G284), S284 (≠ A285), T287 (≠ L288)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), G38 (= G38), G39 (= G39), N43 (= N43), R90 (= R90), S139 (= S140), D256 (= D257)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: K27 (= K27), R29 (= R29)
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
40% identity, 95% coverage: 4:304/318 of query aligns to 4:303/309 of 3n1cA
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), K27 (= K27), R29 (= R29), G39 (= G39), N43 (= N43), R90 (= R90), G138 (= G139), S139 (= S140), D256 (= D257)
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 95% coverage: 4:304/318 of query aligns to 4:303/309 of P06999
- K27 (= K27) binding ; binding
- KPN 185:187 (≠ KPS 185:187) binding in other chain
- NQK 187:189 (≠ SLR 187:189) binding in other chain
- E190 (= E190) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ SLGEQG 224:229) binding in other chain
- S248 (≠ T249) binding in other chain
- S250 (≠ G251) binding
- V252 (≠ T253) binding
- V280 (= V281) binding in other chain
- S284 (≠ A285) binding in other chain
- A286 (= A287) binding
- N289 (≠ H290) binding
- G291 (= G292) binding
- R293 (≠ T294) binding
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
39% identity, 95% coverage: 4:304/318 of query aligns to 4:301/307 of 3uqeA
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding adenosine-5'-triphosphate: K185 (= K185), N187 (≠ S187), S224 (= S224), G226 (= G226), P227 (≠ E227), G229 (= G229), S248 (≠ T249), A254 (= A255), G255 (= G256), M258 (≠ F259), V280 (= V281), G283 (= G284), S284 (≠ A285), T287 (≠ L288)
- binding pyrophosphate 2-: N187 (≠ S187), K189 (≠ R189)
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
39% identity, 95% coverage: 4:304/318 of query aligns to 4:298/304 of 3cqdA
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding adenosine-5'-triphosphate: Y23 (≠ A23), G26 (≠ H26), K27 (= K27), K185 (= K185), N187 (≠ S187), N187 (≠ S187), K189 (≠ R189), S224 (= S224), G226 (= G226), P227 (≠ E227), G229 (= G229), S248 (≠ T249), T251 (= T252), A254 (= A255), G255 (= G256), M258 (≠ F259), V280 (= V281), G283 (= G284), S284 (≠ A285), T287 (= T293)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
31% identity, 89% coverage: 4:286/318 of query aligns to 3:285/319 of 2f02A
- binding adenosine-5'-triphosphate: N186 (≠ S187), S224 (= S224), G226 (= G226), I243 (≠ A243), I246 (≠ M246), G253 (= G254), S254 (≠ A255), G255 (= G256), T258 (≠ F259), M280 (≠ V281), G283 (= G284), M284 (≠ A285)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
28% identity, 86% coverage: 4:278/318 of query aligns to 6:279/314 of 2jgvB
Sites not aligning to the query:
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
28% identity, 86% coverage: 4:278/318 of query aligns to 10:283/318 of 2jg1A
- active site: G259 (= G254), S260 (≠ A255), G261 (= G256), D262 (= D257)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (≠ G40), N193 (≠ S187), S230 (= S224), G232 (= G226), G235 (= G229), I252 (≠ T249), V254 (vs. gap), G259 (= G254), S260 (≠ A255), G261 (= G256), D262 (= D257), T264 (≠ F259)
Sites not aligning to the query:
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
28% identity, 86% coverage: 4:278/318 of query aligns to 7:280/315 of 2jg1C
- active site: G256 (= G254), S257 (≠ A255), G258 (= G256), D259 (= D257)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (= S224), G229 (= G226), A230 (≠ E227), G232 (= G229), I246 (≠ M246), I249 (≠ T249), V251 (vs. gap), V255 (≠ T253), G256 (= G254), S257 (≠ A255), G258 (= G256), D259 (= D257), T261 (≠ F259)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D14), G42 (= G39), K43 (≠ G40), R93 (= R90), C95 (≠ N92), L108 (≠ V107), G140 (= G139), S141 (= S140), D259 (= D257)
Sites not aligning to the query:
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
28% identity, 89% coverage: 4:287/318 of query aligns to 3:293/320 of 2ajrA
Sites not aligning to the query:
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
23% identity, 95% coverage: 4:305/318 of query aligns to 3:303/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (≠ S187), S220 (= S224), G222 (= G226), A223 (≠ E227), G225 (= G229), V242 (≠ L244), G249 (= G254), A250 (= A255), G251 (= G256), D252 (= D257), S279 (≠ G284), V283 (≠ L288)
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
24% identity, 95% coverage: 4:305/318 of query aligns to 3:292/298 of 3julA
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 44% coverage: 146:285/318 of query aligns to 212:353/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
26% identity, 80% coverage: 34:288/318 of query aligns to 35:288/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (≠ S187), K225 (≠ S224), G227 (= G226), I246 (≠ L244), A248 (≠ M246), A257 (= A255), G258 (= G256), F261 (= F259), A286 (= A286), S287 (≠ A287)
- binding alpha-D-ribofuranose: G40 (= G39), K41 (≠ G40), N44 (= N43), E144 (≠ G144), D259 (= D257)
Sites not aligning to the query:
6a8cA Ribokinase from leishmania donovani with adp (see paper)
25% identity, 81% coverage: 38:296/318 of query aligns to 50:315/327 of 6a8cA
Sites not aligning to the query:
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
25% identity, 81% coverage: 38:296/318 of query aligns to 50:315/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G226), A246 (≠ E227), T271 (= T252), A274 (= A255), G275 (= G256), N300 (≠ V281), A303 (≠ G284), V307 (≠ L288)
- binding glycerol: G50 (= G38), G51 (= G39), N55 (= N43), N157 (≠ G139), I159 (≠ L141), E190 (≠ A176)
Sites not aligning to the query:
6a8aA Ribokinase from leishmania donovani with atp (see paper)
25% identity, 81% coverage: 38:296/318 of query aligns to 50:315/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (≠ S187), T243 (≠ S224), G245 (= G226), A246 (≠ E227), G248 (= G229), T271 (= T252), G273 (= G254), A274 (= A255), G275 (= G256), N300 (≠ V281), A303 (≠ G284), V307 (≠ L288)
- binding glycerol: G50 (= G38), G51 (= G39), N55 (= N43)
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
27% identity, 81% coverage: 38:296/318 of query aligns to 26:285/297 of 1tz6A
- active site: F88 (≠ I99), G238 (= G254), A239 (= A255), G240 (= G256), D241 (= D257)
- binding phosphomethylphosphonic acid adenylate ester: N149 (≠ R152), K176 (= K185), E181 (= E190), S209 (= S224), G211 (= G226), A212 (≠ E227), G214 (= G229), A239 (= A255), G240 (= G256), F243 (= F259), N270 (≠ V281), G273 (= G284), A274 (= A285)
- binding 5-aminoimidazole ribonucleoside: G27 (= G39), F88 (≠ I99), Y90 (≠ R105), R151 (≠ A154), M154 (≠ L157), D241 (= D257)
Sites not aligning to the query:
Query Sequence
>Ac3H11_779 FitnessBrowser__acidovorax_3H11:Ac3H11_779
VPALITLTLNPALDLATTTAQVAPTHKLRCGPVQRFAGGGGINVARVLHRLGADVLAWAL
TGGAAGAQVQQLLADEGVPTALQAIAGDTRENFSVVETITGQEFRFVLPGPTLQAAEWQA
CLDALAALPTPPRWLIASGSLPPGTPDDFYARLARALSGRGVRMVVDTSGPPLAAALQAG
VALVKPSLRELRELVQQPLEQAADWCAAAQSLVHSGAAETVALSLGEQGAVLATRTGVWQ
APALNMPATTGTTGAGDCFLAALVWALDRGDAPAEALRWGVAAGAAALLHPGTTLAQAGD
LQRLVHSVPAPVAVATQP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory