SitesBLAST
Comparing Ac3H11_791 FitnessBrowser__acidovorax_3H11:Ac3H11_791 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
37% identity, 95% coverage: 1:346/363 of query aligns to 5:347/353 of 1vciA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
35% identity, 95% coverage: 2:346/363 of query aligns to 6:369/375 of 2d62A
1g291 Malk (see paper)
36% identity, 93% coverage: 5:343/363 of query aligns to 6:363/372 of 1g291
- binding magnesium ion: D69 (≠ G68), E71 (vs. gap), K72 (vs. gap), K79 (≠ R72), D80 (= D73), E292 (≠ S277), D293 (vs. gap), K359 (≠ Q339)
- binding pyrophosphate 2-: S38 (≠ T37), G39 (≠ Q38), C40 (≠ A39), G41 (= G40), K42 (= K41), T43 (= T42), T44 (≠ S43)
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
33% identity, 96% coverage: 5:353/363 of query aligns to 5:368/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ V12), S37 (≠ T37), G38 (≠ Q38), C39 (≠ A39), G40 (= G40), K41 (= K41), S42 (≠ T42), T43 (≠ S43), Q81 (= Q81), R128 (= R126), A132 (≠ E130), S134 (= S132), G136 (= G134), Q137 (= Q135), E158 (= E156), H191 (≠ T189)
- binding magnesium ion: S42 (≠ T42), Q81 (= Q81)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
33% identity, 96% coverage: 5:353/363 of query aligns to 5:368/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ V12), G38 (≠ Q38), C39 (≠ A39), G40 (= G40), K41 (= K41), S42 (≠ T42), T43 (≠ S43), R128 (= R126), S134 (= S132), Q137 (= Q135)
- binding beryllium trifluoride ion: S37 (≠ T37), G38 (≠ Q38), K41 (= K41), Q81 (= Q81), S134 (= S132), G136 (= G134), H191 (≠ T189)
- binding magnesium ion: S42 (≠ T42), Q81 (= Q81)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
33% identity, 96% coverage: 5:353/363 of query aligns to 5:368/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ V12), V17 (≠ W17), G38 (≠ Q38), C39 (≠ A39), G40 (= G40), K41 (= K41), S42 (≠ T42), T43 (≠ S43), R128 (= R126), A132 (≠ E130), S134 (= S132), Q137 (= Q135)
- binding tetrafluoroaluminate ion: S37 (≠ T37), G38 (≠ Q38), K41 (= K41), Q81 (= Q81), S134 (= S132), G135 (= G133), G136 (= G134), E158 (= E156), H191 (≠ T189)
- binding magnesium ion: S42 (≠ T42), Q81 (= Q81)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
33% identity, 96% coverage: 5:353/363 of query aligns to 5:368/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ V12), V17 (≠ W17), G38 (≠ Q38), C39 (≠ A39), G40 (= G40), K41 (= K41), S42 (≠ T42), T43 (≠ S43), R128 (= R126), A132 (≠ E130), S134 (= S132), Q137 (= Q135)
- binding magnesium ion: S42 (≠ T42), Q81 (= Q81)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 96% coverage: 5:353/363 of query aligns to 6:369/371 of P68187
- A85 (≠ I84) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (= K105) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V111) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ I114) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ S116) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ D121) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G134) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D155) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (≠ L225) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ L238) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- W267 (vs. gap) mutation to G: Normal maltose transport but constitutive mal gene expression.
- G278 (≠ A267) mutation to P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- S282 (≠ T271) mutation to L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G284 (= G273) mutation to S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G302 (= G292) mutation to D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- E308 (= E298) mutation to Q: Maltose transport is affected but retains ability to interact with MalT.
- S322 (vs. gap) mutation to F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G340 (= G328) mutation to A: Maltose transport is affected but retains ability to interact with MalT.
- G346 (≠ H334) mutation to S: Normal maltose transport but constitutive mal gene expression.
- F355 (= F343) mutation to Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
33% identity, 96% coverage: 5:353/363 of query aligns to 5:368/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
33% identity, 96% coverage: 5:353/363 of query aligns to 3:366/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ V12), S35 (≠ T37), G36 (≠ Q38), C37 (≠ A39), G38 (= G40), K39 (= K41), S40 (≠ T42), T41 (≠ S43), R126 (= R126), A130 (≠ E130), S132 (= S132), G134 (= G134), Q135 (= Q135)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 96% coverage: 5:353/363 of query aligns to 6:367/369 of P19566
- L86 (≠ N85) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P157) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D162) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- E306 (= E298) mutation to K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
8hprC Lpqy-sugabc in state 4 (see paper)
33% identity, 95% coverage: 2:345/363 of query aligns to 2:354/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (≠ V12), S38 (≠ T37), G39 (≠ Q38), G41 (= G40), K42 (= K41), S43 (≠ T42), Q82 (= Q81), Q133 (≠ E130), G136 (= G133), G137 (= G134), Q138 (= Q135), H192 (≠ T189)
- binding magnesium ion: S43 (≠ T42), Q82 (= Q81)
8hprD Lpqy-sugabc in state 4 (see paper)
32% identity, 95% coverage: 2:345/363 of query aligns to 2:353/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (≠ V12), S38 (≠ T37), C40 (≠ A39), G41 (= G40), K42 (= K41), S43 (≠ T42), T44 (≠ S43), Q82 (= Q81), R129 (= R126), Q133 (≠ E130), S135 (= S132), G136 (= G133), G137 (= G134), Q159 (≠ E156), H192 (≠ T189)
- binding magnesium ion: S43 (≠ T42), Q82 (= Q81)
8hplC Lpqy-sugabc in state 1 (see paper)
34% identity, 85% coverage: 2:310/363 of query aligns to 2:321/384 of 8hplC
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 95% coverage: 2:346/363 of query aligns to 3:382/393 of P9WQI3
- H193 (≠ T189) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
32% identity, 92% coverage: 20:353/363 of query aligns to 13:338/344 of 2awnC
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
39% identity, 62% coverage: 3:228/363 of query aligns to 2:225/348 of 3d31A
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 68% coverage: 1:248/363 of query aligns to 2:256/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 68% coverage: 1:248/363 of query aligns to 2:256/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
35% identity, 68% coverage: 1:248/363 of query aligns to 2:256/353 of 1oxuA
Query Sequence
>Ac3H11_791 FitnessBrowser__acidovorax_3H11:Ac3H11_791
MQLALDSISKKVGAQTWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVT
VDGKDVTGMPVRDRNVAMVYQQFINYPSMKVAANIASPLKLRGEKNIDARVREIASRLHI
DMFLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAG
QSTVVYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNLMA
ASATAQGVRLQGGAELTLPLPQGAATAAGLTVGVRASALRVHARPGDVSVAGVVELAEIS
GSDTFVHASTPWGDLVAQLTGVHYFELGTAITLHLDPAQAYVFGADGRLAQAPARPVTAQ
GGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory