Comparing Ac3H11_990 FitnessBrowser__acidovorax_3H11:Ac3H11_990 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 90% coverage: 1:219/244 of query aligns to 27:245/265 of P07821
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 84% coverage: 1:204/244 of query aligns to 18:218/241 of 4u00A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 84% coverage: 1:205/244 of query aligns to 17:219/240 of 4ymuJ
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
33% identity, 83% coverage: 1:203/244 of query aligns to 19:219/223 of 2pclA
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
29% identity, 84% coverage: 1:204/244 of query aligns to 369:569/590 of 7n59A
Sites not aligning to the query:
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 84% coverage: 1:204/244 of query aligns to 495:695/728 of Q9LVM1
7n5aA Structure of atatm3 in the closed conformation (see paper)
29% identity, 84% coverage: 1:204/244 of query aligns to 368:568/589 of 7n5aA
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 85% coverage: 1:208/244 of query aligns to 21:226/280 of 5x40A
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 83% coverage: 4:205/244 of query aligns to 36:231/378 of P69874
Sites not aligning to the query:
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
30% identity, 98% coverage: 1:240/244 of query aligns to 20:246/278 of 8bmpA
Sites not aligning to the query:
5d3mA Folate ecf transporter: amppnp bound state (see paper)
30% identity, 98% coverage: 1:240/244 of query aligns to 23:249/280 of 5d3mA
Sites not aligning to the query:
Q61102 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial; ATP-binding cassette transporter 7; ABC transporter 7 protein from Mus musculus (Mouse) (see paper)
29% identity, 84% coverage: 1:205/244 of query aligns to 488:689/752 of Q61102
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 84% coverage: 1:204/244 of query aligns to 19:220/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 84% coverage: 1:204/244 of query aligns to 19:220/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 84% coverage: 1:204/244 of query aligns to 19:220/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 84% coverage: 1:204/244 of query aligns to 19:220/242 of 2oljA
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
30% identity, 98% coverage: 1:240/244 of query aligns to 20:246/278 of 8bmsA
Sites not aligning to the query:
6pamA Structure of a bacterial atm1-family abc transporter with mgadp bound (see paper)
32% identity, 84% coverage: 1:205/244 of query aligns to 365:566/586 of 6pamA
Sites not aligning to the query:
4mrvA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 84% coverage: 1:205/244 of query aligns to 370:571/600 of 4mrvA
Sites not aligning to the query:
4mrsA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 84% coverage: 1:205/244 of query aligns to 370:571/600 of 4mrsA
Sites not aligning to the query:
>Ac3H11_990 FitnessBrowser__acidovorax_3H11:Ac3H11_990
LQGIDLQLPAGRWTSIVGPNGAGKSTLLKVLAGLLPRAAVQGEVQLLGRPLAQIPARERA
RQLAWLGQNEGSADDLTSYDVAMLGRLPHQAWLAPPGAADHAAVEQALRTTQAWDWRHRP
LSQLSGGERQRVLLARALAVQAQVLLMDEPLANLDPPHQTDWLHTMRALVEAGGTVVSVL
HEVSLALQADDMVVMANGRVLHQGACGAPATHAALEEVFDHRIQVRHLDGLWMALPSLQR
QNKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory