Comparing B158DRAFT_0779 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
7m4v0 A. Baumannii ribosome-eravacycline complex: 50s (see paper)
84% identity, 100% coverage: 1:51/51 of query aligns to 1:51/51 of 7m4v0
7unr5 30S ribosomal protein S6
78% identity, 100% coverage: 1:51/51 of query aligns to 1:51/51 of 7unr5
5aka1 Em structure of ribosome-srp-ftsy complex in closed state (see paper)
75% identity, 100% coverage: 1:51/51 of query aligns to 4:54/54 of 5aka1
Sites not aligning to the query:
P0A7N9 Large ribosomal subunit protein bL33; 50S ribosomal protein L33 from Escherichia coli (strain K12) (see paper)
75% identity, 100% coverage: 1:51/51 of query aligns to 5:55/55 of P0A7N9
Sites not aligning to the query:
8rd8bk Small ribosomal subunit protein uS5 (see paper)
76% identity, 96% coverage: 2:50/51 of query aligns to 1:49/49 of 8rd8bk
4io91 Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans (see paper)
51% identity, 88% coverage: 5:49/51 of query aligns to 9:53/53 of 4io91
Sites not aligning to the query:
8a22AA uS3m-2 (fragment) (see paper)
46% identity, 98% coverage: 2:51/51 of query aligns to 1:50/50 of 8a22AA
7pktz mL119 (see paper)
49% identity, 96% coverage: 1:49/51 of query aligns to 5:53/53 of 7pktz
6xywAC At4g35490 (see paper)
49% identity, 92% coverage: 5:51/51 of query aligns to 5:51/51 of 6xywAC
6z1pAE mS93 (see paper)
47% identity, 90% coverage: 5:50/51 of query aligns to 6:52/57 of 6z1pAE
Sites not aligning to the query:
9b0016 50S ribosomal protein L13 (see paper)
40% identity, 98% coverage: 1:50/51 of query aligns to 4:53/53 of 9b0016
Sites not aligning to the query:
5dm61 Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans (see paper)
55% identity, 65% coverage: 5:37/51 of query aligns to 11:43/54 of 5dm61
Sites not aligning to the query:
4v8eA6 structure analysis of ribosomal decoding (near-cognate tRNA-tyr complex). (see paper)
48% identity, 65% coverage: 17:49/51 of query aligns to 13:45/45 of 4v8eA6
6yweX structure of the mitoribosome from Neurospora crassa in the P/E tRNA bound state (see paper)
40% identity, 88% coverage: 5:49/51 of query aligns to 6:48/48 of 6yweX
Sites not aligning to the query:
9c4g0 Cutibacterium acnes 50s ribosomal subunit with clindamycin bound (see paper)
39% identity, 96% coverage: 1:49/51 of query aligns to 2:50/50 of 9c4g0
>B158DRAFT_0779
MRDKIRLVSSAGTGHFYTTDKNKKNMPGKMEIKKFDPTIRKHVIYKEAKIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory