SitesBLAST
Comparing BPHYT_RS00200 FitnessBrowser__BFirm:BPHYT_RS00200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
29% identity, 96% coverage: 3:452/467 of query aligns to 7:473/485 of 2f2aA
- active site: K79 (= K75), S154 (= S150), S155 (= S151), S173 (= S169), T175 (≠ G171), G176 (= G172), G177 (= G173), S178 (= S174), Q181 (≠ I177)
- binding glutamine: G130 (≠ S126), S154 (= S150), D174 (= D170), T175 (≠ G171), G176 (= G172), S178 (= S174), F206 (vs. gap), Y309 (≠ F304), Y310 (≠ E305), R358 (vs. gap), D425 (≠ T403)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
29% identity, 96% coverage: 3:452/467 of query aligns to 7:473/485 of 2dqnA
- active site: K79 (= K75), S154 (= S150), S155 (= S151), S173 (= S169), T175 (≠ G171), G176 (= G172), G177 (= G173), S178 (= S174), Q181 (≠ I177)
- binding asparagine: M129 (≠ W125), G130 (≠ S126), T175 (≠ G171), G176 (= G172), S178 (= S174), Y309 (≠ F304), Y310 (≠ E305), R358 (vs. gap), D425 (≠ T403)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
29% identity, 97% coverage: 11:462/467 of query aligns to 14:476/478 of 3h0mA
- active site: K72 (= K75), S147 (= S150), S148 (= S151), S166 (= S169), T168 (≠ G171), G169 (= G172), G170 (= G173), S171 (= S174), Q174 (≠ I177)
- binding glutamine: M122 (≠ W125), G123 (≠ S126), D167 (= D170), T168 (≠ G171), G169 (= G172), G170 (= G173), S171 (= S174), F199 (vs. gap), Y302 (vs. gap), R351 (vs. gap), D418 (= D394)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
29% identity, 97% coverage: 11:462/467 of query aligns to 14:476/478 of 3h0lA
- active site: K72 (= K75), S147 (= S150), S148 (= S151), S166 (= S169), T168 (≠ G171), G169 (= G172), G170 (= G173), S171 (= S174), Q174 (≠ I177)
- binding asparagine: G123 (≠ S126), S147 (= S150), G169 (= G172), G170 (= G173), S171 (= S174), Y302 (vs. gap), R351 (vs. gap), D418 (= D394)
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
29% identity, 98% coverage: 3:459/467 of query aligns to 7:480/490 of 4yjiA
- active site: K79 (= K75), S158 (= S150), S159 (= S151), G179 (= G171), G180 (= G172), G181 (= G173), A182 (≠ S174)
- binding n-(4-hydroxyphenyl)acetamide (tylenol): L81 (= L77), G132 (= G124), S158 (= S150), G179 (= G171), G180 (= G172), A182 (≠ S174)
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
33% identity, 84% coverage: 65:454/467 of query aligns to 85:499/508 of 3a1iA
- active site: K95 (= K75), S170 (= S150), S171 (= S151), G189 (≠ S169), Q191 (≠ G171), G192 (= G172), G193 (= G173), A194 (≠ S174), I197 (= I177)
- binding benzamide: F145 (≠ W125), S146 (= S126), G147 (= G127), Q191 (≠ G171), G192 (= G172), G193 (= G173), A194 (≠ S174), W327 (vs. gap)
3kfuE Crystal structure of the transamidosome (see paper)
32% identity, 98% coverage: 9:464/467 of query aligns to 7:466/468 of 3kfuE
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 98% coverage: 4:460/467 of query aligns to 131:596/607 of Q7XJJ7
- K205 (= K75) mutation to A: Loss of activity.
- SS 281:282 (= SS 150:151) mutation to AA: Loss of activity.
- GGGS 302:305 (= GGGS 171:174) binding
- S305 (= S174) mutation to A: Loss of activity.
- R307 (= R176) mutation to A: Loss of activity.
- S360 (≠ P228) mutation to A: No effect.
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
27% identity, 98% coverage: 4:460/467 of query aligns to 131:596/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (= G124), T258 (≠ G127), S281 (= S150), G302 (= G171), G303 (= G172), S305 (= S174), S472 (≠ A332), I532 (≠ L397), M539 (≠ T403)
Sites not aligning to the query:
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
28% identity, 97% coverage: 3:456/467 of query aligns to 6:448/457 of 5h6sC
- active site: K77 (= K75), S152 (= S150), S153 (= S151), L173 (≠ G171), G174 (= G172), G175 (= G173), S176 (= S174)
- binding 4-oxidanylbenzohydrazide: C126 (≠ G124), R128 (≠ S126), W129 (≠ G127), S152 (= S150), L173 (≠ G171), G174 (= G172), S176 (= S174), W306 (= W308), F338 (vs. gap)
3a2qA Structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate (see paper)
28% identity, 98% coverage: 8:465/467 of query aligns to 11:481/482 of 3a2qA
- active site: K69 (= K75), S147 (= S150), S148 (= S151), N166 (≠ S169), A168 (≠ G171), A169 (≠ G172), G170 (= G173), A171 (≠ S174), I174 (= I177)
- binding 6-aminohexanoic acid: G121 (= G124), G121 (= G124), N122 (≠ W125), S147 (= S150), A168 (≠ G171), A168 (≠ G171), A169 (≠ G172), A171 (≠ S174), C313 (vs. gap)
Q84DC4 Mandelamide hydrolase; EC 3.5.1.86 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
29% identity, 97% coverage: 3:455/467 of query aligns to 29:490/507 of Q84DC4
- T31 (≠ A5) mutation to I: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with N-437.
- K100 (= K75) mutation to A: Abolishes activity on mandelamide.
- S180 (= S150) mutation to A: Significantly decreases activity on mandelamide.
- S181 (= S151) mutation to A: Significantly decreases activity on mandelamide.
- G202 (= G172) mutation to A: Increase in KM values for aromatic substrates, but not aliphatic substrates. Active against lactamide but not against mandelamide; when associated with H-207 and E-382.; mutation to V: Increase in KM values for aromatic substrates, but not aliphatic substrates.
- S204 (= S174) mutation to A: Abolishes activity on mandelamide.
- Q207 (≠ I177) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with E-382. Active against lactamide but not against mandelamide; when associated with A-202 and E-382. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with S-316 and N-437.
- S316 (≠ A283) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-437.
- Q382 (≠ E344) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with H-207. Active against lactamide but not against mandelamide; when associated with A-202 and H-207.
- I437 (≠ T403) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with I-31. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-316.
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
34% identity, 48% coverage: 11:232/467 of query aligns to 10:233/457 of 6c6gA
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
29% identity, 96% coverage: 4:452/467 of query aligns to 8:476/487 of 1m21A
- active site: K81 (= K75), S160 (= S150), S161 (= S151), T179 (≠ S169), T181 (≠ G171), D182 (≠ G172), G183 (= G173), S184 (= S174), C187 (≠ I177)
- binding : A129 (vs. gap), N130 (vs. gap), F131 (vs. gap), C158 (≠ G148), G159 (= G149), S160 (= S150), S184 (= S174), C187 (≠ I177), I212 (≠ W199), R318 (≠ P302), L321 (≠ I314), L365 (≠ V360), F426 (vs. gap)
1o9oA Crystal structure of the s131a mutant of malonamidase e2 complexed with malonamate from bradyrhizobium japonicum (see paper)
28% identity, 95% coverage: 1:445/467 of query aligns to 1:400/412 of 1o9oA
- active site: K62 (= K75), A131 (≠ S150), S132 (= S151), T150 (≠ S169), T152 (≠ G171), G153 (= G172), G154 (= G173), S155 (= S174), R158 (≠ I177)
- binding 3-amino-3-oxopropanoic acid: G130 (= G149), T152 (≠ G171), G153 (= G172), G154 (= G173), S155 (= S174), R158 (≠ I177), P359 (≠ T403)
1ocmA The crystal structure of malonamidase e2 covalently complexed with pyrophosphate from bradyrhizobium japonicum (see paper)
28% identity, 95% coverage: 1:445/467 of query aligns to 1:400/412 of 1ocmA
- active site: K62 (= K75), S131 (= S150), S132 (= S151), T152 (≠ G171), G153 (= G172), G154 (= G173), S155 (= S174)
- binding pyrophosphate 2-: R113 (= R132), S131 (= S150), Q151 (≠ D170), T152 (≠ G171), G153 (= G172), G154 (= G173), S155 (= S174), R158 (≠ I177), P359 (≠ T403)
4gysB Granulibacter bethesdensis allophanate hydrolase co-crystallized with malonate (see paper)
29% identity, 86% coverage: 39:441/467 of query aligns to 32:427/461 of 4gysB
- active site: K72 (= K75), S146 (= S150), S147 (= S151), T165 (≠ S169), T167 (≠ G171), A168 (≠ G172), G169 (= G173), S170 (= S174), V173 (≠ I177)
- binding malonate ion: A120 (≠ G124), G122 (≠ S126), S146 (= S150), T167 (≠ G171), A168 (≠ G172), S170 (= S174), S193 (vs. gap), G194 (≠ W197), V195 (≠ P198), R200 (≠ E203), Y297 (≠ W297), R305 (= R312)
Q9FR37 Amidase 1; AtAMI1; Translocon at the outer membrane of chloroplasts 64-I; AtTOC64-I; EC 3.5.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 28% coverage: 67:196/467 of query aligns to 28:159/425 of Q9FR37
- K36 (= K75) active site, Charge relay system; mutation to A: Loss of catalytic activity.; mutation to R: Reduces catalytic activity 10-fold.
- S113 (= S150) active site, Charge relay system; mutation S->A,T: Loss of catalytic activity.
- S114 (= S151) mutation to A: Loss of catalytic activity.; mutation to T: Reduces catalytic activity 400-fold.
- D133 (= D170) mutation to A: Loss of catalytic activity.; mutation to E: Reduces catalytic activity 600-fold.
- S137 (= S174) active site, Acyl-ester intermediate; mutation to A: Reduces catalytic activity 170-fold.; mutation to T: Loss of catalytic activity.
- C145 (= C182) mutation C->A,S: Reduces catalytic activity 10-fold.
Sites not aligning to the query:
- 214 S→T: Slightly reduces catalytic activity.
4n0iA Crystal structure of s. Cerevisiae mitochondrial gatfab in complex with glutamine (see paper)
25% identity, 82% coverage: 67:451/467 of query aligns to 30:449/450 of 4n0iA
- active site: K38 (= K75), S116 (= S150), S117 (= S151), T135 (≠ S169), T137 (≠ G171), G138 (= G172), G139 (= G173), S140 (= S174), L143 (≠ I177)
- binding glutamine: G89 (≠ S126), T137 (≠ G171), G138 (= G172), S140 (= S174), Y168 (vs. gap), Y271 (≠ D289), Y272 (≠ L290), R320 (vs. gap), D404 (vs. gap)
Q936X2 Allophanate hydrolase; EC 3.5.1.54 from Pseudomonas sp. (strain ADP) (see paper)
28% identity, 87% coverage: 48:451/467 of query aligns to 61:460/605 of Q936X2
- K91 (= K75) mutation to A: Loss of activity.
- S165 (= S150) mutation to A: Loss of activity.
- S189 (= S174) mutation to A: Loss of activity.
Query Sequence
>BPHYT_RS00200 FitnessBrowser__BFirm:BPHYT_RS00200
MPTVADAAASIRCGELTPVELVQRCLDSIKTHNPTLHAFGDVYAEEALRYAETLTREAKE
NRTRGGLHGVPFAIKDLFATAGLRTTRGSLTAMNWVPQEDAPVIRRLKEAGAILLGKAAT
TEFGWSGASYSRVFGNGCNPWDARLTSGGSSSGSAISVAARMVPASLGSDGGGSVRIPSA
FCGVFAMKGSHGRIPTWPWSATEMLSHAGPITRTVRDSALLFDVLAGPDSRDHQALPAAT
GSYLARCEEPLKRVRVAFCPTLFGVDVDPEISRVVGAAVERIARALPIDLEMPVLGWHDP
LPTFETLWVAGRGIVYGQTLKNCADQLDPGFARLIGRASDYSLEDYLTAIQRRATFACQV
HALFDTYDFLLTPTLPILPFDADLIAPPELDTHDSALPWACWTPFTYPFNLSGNPAASLP
CGWSDTGLPVGLQVVGPRFADADVLQFCSAIEAIMPWAHRLPPMLGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory