Comparing BPHYT_RS00415 FitnessBrowser__BFirm:BPHYT_RS00415 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
55% identity, 92% coverage: 32:420/422 of query aligns to 5:393/396 of 5dvjA
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
55% identity, 92% coverage: 32:420/422 of query aligns to 5:393/396 of 5dviA
8hqqA Crystal structure of the glucose-binding protein sar11_0769 from "candidatus pelagibacter ubique" htcc1062 bound to glucose
51% identity, 90% coverage: 31:408/422 of query aligns to 4:384/398 of 8hqqA
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
49% identity, 88% coverage: 32:402/422 of query aligns to 7:375/395 of 4r2bA
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
31% identity, 82% coverage: 31:376/422 of query aligns to 2:347/392 of 2b3fA
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
31% identity, 82% coverage: 31:376/422 of query aligns to 2:347/392 of 2b3bC
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
31% identity, 82% coverage: 31:376/422 of query aligns to 2:347/392 of 2b3bA
Sites not aligning to the query:
3vxcA Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
27% identity, 49% coverage: 79:284/422 of query aligns to 48:259/398 of 3vxcA
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
24% identity, 52% coverage: 80:297/422 of query aligns to 50:265/390 of 3oo6A
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
27% identity, 48% coverage: 73:273/422 of query aligns to 50:252/406 of 7ehqA
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
28% identity, 34% coverage: 133:275/422 of query aligns to 105:251/396 of 4c1tA
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
25% identity, 77% coverage: 76:399/422 of query aligns to 46:342/392 of 4g68A
Sites not aligning to the query:
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
30% identity, 32% coverage: 132:267/422 of query aligns to 141:276/471 of G7CES0
Sites not aligning to the query:
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
30% identity, 32% coverage: 132:267/422 of query aligns to 108:243/435 of 7apeA
Sites not aligning to the query:
7c0kA Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
24% identity, 67% coverage: 66:349/422 of query aligns to 52:321/396 of 7c0kA
Sites not aligning to the query:
7c0oB Crystal structure of a dinucleotide-binding protein (y56f) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (see paper)
24% identity, 67% coverage: 66:349/422 of query aligns to 52:321/397 of 7c0oB
Sites not aligning to the query:
7c0kB Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
24% identity, 67% coverage: 66:349/422 of query aligns to 53:322/397 of 7c0kB
Sites not aligning to the query:
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
26% identity, 51% coverage: 73:287/422 of query aligns to 41:266/385 of 2i58A
Sites not aligning to the query:
6preA Sbp rafe in complex with verbascose (see paper)
26% identity, 51% coverage: 73:287/422 of query aligns to 42:267/386 of 6preA
Sites not aligning to the query:
>BPHYT_RS00415 FitnessBrowser__BFirm:BPHYT_RS00415
MPKPAGRTAKLTVYALGVAAVLACGAARSAEVEVLHYWTSGGEAKSAQVLKQMLDEKGDT
WKDFAVAGGGGGNAMTALKTRVIAGNPPAAAQIKGPAIQEWGDEGVLVSINDVAKREGWD
KLIPPQISGIMKYKGQYVAAPVNVHRVNRLWINADALKKVNAQPPATWDEFFRTAEALQK
AGITPVAIGGQQWQDAETFETVALGVGGAAFYEKAFVQLDQSTLRGPTMVKALETFKKIK
AYTDKAQTGRDWNLATGMVISGKAAMQFMGDWAKGEFSVAGKVPGKDYLCVPAPGSQNAY
TFNVDSFAFFKVRSADVEKGQKDLASLLLSPKFQEIFNLNKGSIPVRQGMDLSKFDTCAQ
RSAADFTSAQAKGTLVPSWAHDMVDTPAVEGAFYDVIGNFWNDDNESAQQAADKLAVAAK
TR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory