Comparing BPHYT_RS00495 FitnessBrowser__BFirm:BPHYT_RS00495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3s8yA Bromide soaked structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
61% identity, 100% coverage: 1:275/276 of query aligns to 2:277/277 of 3s8yA
3i6yA Structure of an esterase from the oil-degrading bacterium oleispira antarctica (see paper)
61% identity, 100% coverage: 1:275/276 of query aligns to 2:277/278 of 3i6yA
P33018 S-formylglutathione hydrolase YeiG; FGH; EC 3.1.2.12 from Escherichia coli (strain K12) (see paper)
57% identity, 99% coverage: 1:274/276 of query aligns to 1:276/278 of P33018
P10768 S-formylglutathione hydrolase; FGH; Esterase D; Methylumbelliferyl-acetate deacetylase; EC 3.1.2.12; EC 3.1.1.56 from Homo sapiens (Human) (see 4 papers)
54% identity, 100% coverage: 1:275/276 of query aligns to 3:281/282 of P10768
3fcxB Crystal structure of human esterase d (see paper)
53% identity, 100% coverage: 1:275/276 of query aligns to 1:275/275 of 3fcxB
3fcxA Crystal structure of human esterase d (see paper)
53% identity, 100% coverage: 1:275/276 of query aligns to 3:267/268 of 3fcxA
Q8LAS8 S-formylglutathione hydrolase; AtSFGH; Esterase D; EC 3.1.2.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
55% identity, 96% coverage: 11:274/276 of query aligns to 15:282/284 of Q8LAS8
3e4dA Structural and kinetic study of an s-formylglutathione hydrolase from agrobacterium tumefaciens (see paper)
47% identity, 99% coverage: 1:274/276 of query aligns to 2:277/278 of 3e4dA
P40363 S-formylglutathione hydrolase; FGH; EC 3.1.2.12 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
43% identity, 93% coverage: 19:274/276 of query aligns to 19:296/299 of P40363
Sites not aligning to the query:
4flmA S-formylglutathione hydrolase w197i variant containing copper (see paper)
42% identity, 99% coverage: 1:274/276 of query aligns to 1:285/288 of 4flmA
4rotA Crystal structure of esterase a from streptococcus pyogenes
31% identity, 55% coverage: 18:169/276 of query aligns to 14:153/268 of 4rotA
Sites not aligning to the query:
7l0aA Crystal structure of s-formylglutathione hydrolase (frmb) from staphylococcus aureus, apoenzyme (see paper)
24% identity, 56% coverage: 18:171/276 of query aligns to 15:155/249 of 7l0aA
6wcxA Fphf, staphylococcus aureus fluorophosphonate-binding serine hydrolases f, substrate bound (see paper)
23% identity, 63% coverage: 18:190/276 of query aligns to 9:171/255 of 6wcxA
Sites not aligning to the query:
6vhdA Fphf, staphylococcus aureus fluorophosphonate-binding serine hydrolases f, kt129 bound (see paper)
23% identity, 63% coverage: 18:190/276 of query aligns to 9:171/255 of 6vhdA
Sites not aligning to the query:
7xrtA Bacteroides thetaiotaomicron ferulic acid esterase (bt_4077)
31% identity, 55% coverage: 20:171/276 of query aligns to 12:156/268 of 7xrtA
Sites not aligning to the query:
P9WM39 Esterase Rv1288; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 55% coverage: 17:169/276 of query aligns to 177:318/456 of P9WM39
Sites not aligning to the query:
>BPHYT_RS00495 FitnessBrowser__BFirm:BPHYT_RS00495
MERVEHHASSDGWQDVYQHESTTLGCTMKVGVYLPPQAQHGKVPVLYWLSGLTCTEQNFI
TKSAVQRYAAEHGIAVVVPDTSPRGESVANDPAYDLGQGAGFYVNATQAPWAANYRMYDY
VVQELPALIEAHFPVTAERSISGHSMGGHGALVIALRNPGRYRSVSAFSPIVAPTEVPWG
HKAFTAYLGGDQQAWKQYDTVELIRTAQERLPLLVEQGLSDEFLESQLRPELLRKACEET
GHPLTLNLRPGHDHSYYFIASFIGEHIAHHASALNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory