Comparing BPHYT_RS00645 FitnessBrowser__BFirm:BPHYT_RS00645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
39% identity, 93% coverage: 28:401/402 of query aligns to 16:388/412 of 7ru7A
6knhC Crystal structure of sbnh in complex with citrate, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
29% identity, 94% coverage: 19:397/402 of query aligns to 7:378/384 of 6knhC
6kniA Crystal structure of sbnh in complex with the cofactor plp, a plp- dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
29% identity, 94% coverage: 19:397/402 of query aligns to 7:374/381 of 6kniA
6knkA Crystal structure of sbnh in complex with citryl-diaminoethane (see paper)
29% identity, 94% coverage: 19:397/402 of query aligns to 8:376/383 of 6knkA
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
30% identity, 93% coverage: 28:400/402 of query aligns to 12:375/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
30% identity, 93% coverage: 28:400/402 of query aligns to 10:368/394 of 3c5qA
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
28% identity, 96% coverage: 19:402/402 of query aligns to 3:361/385 of 2yxxA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
26% identity, 93% coverage: 14:387/402 of query aligns to 16:392/434 of 1twiA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
26% identity, 93% coverage: 14:387/402 of query aligns to 20:396/438 of Q58497
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
28% identity, 96% coverage: 19:402/402 of query aligns to 4:362/386 of Q9X1K5
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
26% identity, 93% coverage: 14:387/402 of query aligns to 16:392/434 of 1tufA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
28% identity, 96% coverage: 16:402/402 of query aligns to 15:392/418 of 4xg1B
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
27% identity, 96% coverage: 12:397/402 of query aligns to 13:393/422 of 6n2aA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
27% identity, 96% coverage: 16:402/402 of query aligns to 13:367/393 of 4xg1A
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 93% coverage: 16:387/402 of query aligns to 28:410/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
27% identity, 93% coverage: 16:387/402 of query aligns to 27:409/446 of 1hkvA
1f3tB Crystal structure of trypanosoma brucei ornithine decarboxylase (odc) complexed with putrescine, odc's reaction product. (see paper)
25% identity, 92% coverage: 14:382/402 of query aligns to 3:348/381 of 1f3tB
7u6pA Structure of an intellectual disability-associated ornithine decarboxylase variant g84r (see paper)
26% identity, 82% coverage: 58:387/402 of query aligns to 66:381/409 of 7u6pA
2oo0A A structural insight into the inhibition of human and leishmania donovani ornithine decarboxylases by 3-aminooxy-1-aminopropane (see paper)
26% identity, 82% coverage: 58:387/402 of query aligns to 76:391/419 of 2oo0A
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
25% identity, 93% coverage: 16:387/402 of query aligns to 29:407/442 of 5x7nA
>BPHYT_RS00645 FitnessBrowser__BFirm:BPHYT_RS00645
MSLTFLQRPPGLQFNGIDVRQLADRAGQTPFFAYDRSAIDTRVRELRSLLPSAMQLHYSI
KANPMPAVIHYLAQRVDGFDVASAQEMALALDAGATPDSIGFAGPGKSHDDLRRAVASGV
NVHVESDTQLRLVTALGWELGVQPNVVIRINPDFQVGHSGMRMGGSAAPFGVDVDQIPAL
LHELETREVALAGFHVFWGSQCLHASTIIEAQRQSVDLILRLASDLPRPLRFVNLGGGFG
IPYFPGETPLDTKVVCEAMHDWLPRLCERLPGTTPILELGRYLVGEAGIYVCRVIDRKVS
RGRTFVITDGGLHHHLAASGNFGQVLRRNFPVVIGNRPDGISRERCYVVGCLCTPLDRLA
DDVELPEAHIGDFVVVKQSGAYGHSASPVHFLSHPEPVEMLV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory