SitesBLAST
Comparing BPHYT_RS01060 FitnessBrowser__BFirm:BPHYT_RS01060 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
51% identity, 98% coverage: 4:412/417 of query aligns to 40:440/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
51% identity, 96% coverage: 4:405/417 of query aligns to 2:396/433 of 8gy2B
- binding heme c: C18 (= C20), C21 (= C23), H22 (= H24), T46 (= T48), I48 (= I50), Y59 (= Y61), L68 (≠ V70), R73 (= R75), V79 (≠ M81), Y80 (= Y82), M83 (= M85), F88 (≠ Y90), R126 (= R128), H165 (= H177), C166 (= C178), C169 (= C181), H170 (= H182), I201 (≠ V212), A202 (= A213), P203 (≠ N214), L205 (= L216), W216 (= W227), F224 (= F235), A234 (= A245), V235 (≠ A246), F236 (= F247), F236 (= F247), M239 (= M250), N301 (≠ S311), C302 (= C312), C305 (= C315), H306 (= H316), M316 (≠ T326), F317 (= F327), P318 (= P328), L320 (= L330), P324 (= P334), G342 (≠ N352), S352 (≠ T362), V354 (≠ F364), M356 (= M366), F359 (= F369), M375 (≠ I385)
- binding ubiquinone-10: C21 (= C23), L34 (= L36), P39 (= P41), P81 (= P83), L129 (= L131), W132 (= W134), E168 (≠ S180), R173 (= R185), I197 (= I208), D241 (= D252)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 96% coverage: 8:406/417 of query aligns to 1:387/418 of 7w2jC
- binding heme c: C13 (= C20), C16 (= C23), H17 (= H24), T42 (= T48), I44 (= I50), Y55 (= Y61), L75 (≠ M81), Y76 (= Y82), A78 (= A84), M79 (= M85), R122 (= R128), H161 (= H177), C162 (= C178), C165 (= C181), H166 (= H182), A191 (= A213), P192 (≠ N214), R223 (≠ A245), P227 (≠ G249), M228 (= M250), V289 (≠ S311), C290 (= C312), C293 (= C315), H294 (= H316), Y305 (≠ T326), Y306 (≠ F327), P307 (= P328), L309 (= L330), N312 (= N333), T313 (≠ P334), T314 (≠ V335), D322 (≠ S343), I327 (≠ V348), V331 (= V355), R333 (≠ T357), I340 (≠ F364), M342 (= M366), P343 (= P367), F345 (= F369)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 96% coverage: 8:406/417 of query aligns to 1:401/413 of 8jejC
- binding heme c: C13 (= C20), C16 (= C23), H17 (= H24), T42 (= T48), I44 (= I50), F60 (= F66), L64 (≠ V70), L75 (≠ M81), Y76 (= Y82), M79 (= M85), P80 (= P86), Y84 (= Y90), R122 (= R128), C162 (= C178), C165 (= C181), H166 (= H182), I186 (= I208), W189 (≠ Y211), A191 (= A213), P192 (≠ N214), I194 (≠ L216), W205 (= W227), Y213 (≠ F235), R223 (≠ A245), M228 (= M250), V303 (≠ S311), C304 (= C312), C307 (= C315), H308 (= H316), Y320 (≠ F327), P321 (= P328), L323 (= L330), T327 (≠ P334), T328 (≠ V335), D336 (≠ S343), I341 (≠ V348), V345 (= V355), R347 (≠ T357), I354 (≠ F364), M356 (= M366), F359 (= F369), I376 (≠ V381)
- binding ubiquinone-10: M36 (≠ I42), P77 (= P83), S124 (≠ P130), W128 (= W134), C165 (= C181), L173 (= L189)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 97% coverage: 8:413/417 of query aligns to 41:436/440 of 8gy3A
- binding heme c: Y52 (≠ D19), C53 (= C20), C56 (= C23), H57 (= H24), S84 (≠ T48), I86 (= I50), W97 (≠ Y61), F102 (= F66), L117 (≠ M81), F121 (≠ M85), F126 (≠ Y90), R163 (= R128), C203 (= C178), C206 (= C181), H207 (= H182), A232 (= A213), P233 (≠ N214), L235 (= L216), W245 (= W227), Y253 (≠ F235), L254 (= L236), G263 (≠ T244), S264 (≠ A245), M269 (= M250), Y292 (≠ L273), C337 (= C312), C340 (= C315), H341 (= H316), P353 (= P328), L355 (= L330), N358 (= N333), N359 (≠ P334), V372 (≠ I347), I377 (≠ N352), G382 (= G356), Q383 (≠ T357), I386 (≠ V360), M388 (= M366), F391 (= F369)
- binding ubiquinone-10: E55 (≠ A22), T76 (= T40), F78 (≠ I42), Y118 (= Y82), P119 (= P83), I160 (≠ L125), G166 (vs. gap), Q167 (≠ L131), F169 (≠ Y133), W170 (= W134), H202 (= H177), R210 (= R185), L213 (= L194)
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
36% identity, 29% coverage: 288:407/417 of query aligns to 337:454/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ S311), C360 (= C312), C363 (= C315), H364 (= H316), P376 (= P328), P377 (≠ A329), L378 (= L330), F383 (≠ V335), N400 (= N352), G401 (≠ T353), Y410 (≠ T362), S412 (≠ F364), M414 (= M366), M417 (≠ F369)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
36% identity, 29% coverage: 288:407/417 of query aligns to 340:457/457 of 4ax3D
- binding heme c: C363 (= C312), C366 (= C315), H367 (= H316), P379 (= P328), P380 (≠ A329), L381 (= L330), S384 (≠ N333), F386 (≠ V335), N403 (= N352), G404 (≠ T353), S415 (≠ F364), M417 (= M366), M420 (≠ F369)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
36% identity, 29% coverage: 288:407/417 of query aligns to 338:455/456 of 5oboA
- binding heme c: T360 (≠ S311), C361 (= C312), C364 (= C315), H365 (= H316), P377 (= P328), P378 (≠ A329), L379 (= L330), S382 (≠ N333), F384 (≠ V335), I395 (= I347), N401 (= N352), G402 (≠ T353), S413 (≠ F364), M415 (= M366), M418 (≠ F369)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase (see paper)
36% identity, 24% coverage: 308:405/417 of query aligns to 26:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C312), C33 (= C315), H34 (= H316), Y46 (≠ F327), P47 (= P328), T54 (≠ V335), V66 (≠ I347), I67 (≠ V348), R73 (≠ T353), I80 (≠ V360), M82 (= M366), P83 (= P367)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
33% identity, 24% coverage: 308:405/417 of query aligns to 343:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C312), C350 (= C315), H351 (= H316), F362 (= F327), P363 (= P328), P364 (≠ A329), L365 (= L330), S368 (≠ N333), Y370 (≠ V335), I382 (≠ V348), L386 (vs. gap), S387 (≠ N352), G388 (≠ T353), I390 (≠ V355), V392 (≠ T357), Y397 (≠ T362), N398 (≠ Q363), G399 (≠ F364), V400 (≠ T365), M401 (= M366)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
6adqC Respiratory complex ciii2civ2sod2 from mycobacterium smegmatis (see paper)
28% identity, 55% coverage: 161:388/417 of query aligns to 1:181/223 of 6adqC
- binding (2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate: K126 (= K321), D138 (≠ V335)
- binding heme c: C16 (= C178), C19 (= C181), H20 (= H182), P32 (≠ D219), L34 (= L221), T37 (≠ L224), A41 (≠ D231), V42 (≠ I232), F44 (≠ E234), Q45 (≠ F235), R50 (= R240), M51 (≠ N241), P52 (= P242), A53 (≠ G249), L75 (≠ V269), C117 (= C312), C120 (= C315), H121 (= H316), L130 (≠ D325), P137 (= P334), L139 (≠ V336), I147 (≠ L344), M151 (≠ V348), P155 (≠ N352), P155 (≠ N352), Q156 (≠ T353), Q156 (≠ T353), M158 (= M366), P159 (= P367), F161 (= F369)
Sites not aligning to the query:
- binding (2R)-2-(hexadecanoyloxy)-3-{[(S)-hydroxy{[(1R,2R,3R,4R,5R,6S)-2,3,4,5,6-pentahydroxycyclohexyl]oxy}phosphoryl]oxy}propyl (9S)-9-methyloctadecanoate: 182, 186, 189, 190, 191, 202, 206, 207
- binding menaquinone-9: 193, 199, 202, 202, 205
Query Sequence
>BPHYT_RS01060 FitnessBrowser__BFirm:BPHYT_RS01060
DANDTALIRRGAYLAVLGDCAACHVAKDGKAFVGGLPITTPIGTLYTTNITPDPATGIGN
YTPSDFERAVRRGIRRDGSPMYPAMPYPSYAHVSDDDVRALYAYFMHGVAPVDSPNRASG
IPWPLSMRWPLTYWRWAFAPKVQPAAHTDIDSATAAGAAHDAALLERGRYLVEGLMHCGS
CHTPRGVGLQEKALGDADGSDYLSGGVIDHYVANSLRGDDLTGLGRWSQADIVEFLRTGR
NPETAAFGGMRDVVQHSSQFLNDTDLLAVATYLKSLPGNHPAGHYAYAAAAGAALAKGDV
SARGAIDYLNSCAACHLSSGKGYRDTFPALAGNPVVNAKDPTSLINIVLNGNTEVGTSRV
PTQFTMPPFGDRLTDAEVANVVTFIRTSWGNHAPDVNADEVAKVRAQTHAPTVARRQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory