Comparing BPHYT_RS01215 FitnessBrowser__BFirm:BPHYT_RS01215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
33% identity, 77% coverage: 66:318/330 of query aligns to 73:301/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
33% identity, 77% coverage: 66:318/330 of query aligns to 72:300/303 of 8skyB
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
37% identity, 56% coverage: 134:318/330 of query aligns to 94:278/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
37% identity, 56% coverage: 134:318/330 of query aligns to 94:278/290 of 8gsrA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
34% identity, 56% coverage: 137:320/330 of query aligns to 95:278/280 of 6j5xB
Sites not aligning to the query:
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
34% identity, 56% coverage: 137:320/330 of query aligns to 95:278/280 of 6j5xA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
36% identity, 58% coverage: 130:319/330 of query aligns to 89:276/279 of 6v77B
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
35% identity, 54% coverage: 134:312/330 of query aligns to 76:254/265 of 3r6oA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
33% identity, 75% coverage: 73:318/330 of query aligns to 58:274/277 of 6iymA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
34% identity, 59% coverage: 124:319/330 of query aligns to 77:267/269 of 4dbhA
Sites not aligning to the query:
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
35% identity, 59% coverage: 126:319/330 of query aligns to 67:248/252 of 3qdfA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
33% identity, 61% coverage: 119:318/330 of query aligns to 19:213/216 of 6sbiA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
35% identity, 61% coverage: 119:318/330 of query aligns to 25:219/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
35% identity, 61% coverage: 119:318/330 of query aligns to 20:214/218 of 6fogA
Sites not aligning to the query:
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
34% identity, 58% coverage: 132:321/330 of query aligns to 89:263/264 of 6jvwB
Sites not aligning to the query:
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
32% identity, 72% coverage: 82:320/330 of query aligns to 22:232/233 of 6j5yA
1gttA Crystal structure of hpce (see paper)
36% identity, 46% coverage: 137:289/330 of query aligns to 242:390/421 of 1gttA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
25% identity, 55% coverage: 129:308/330 of query aligns to 23:222/247 of 1nkqA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
30% identity, 53% coverage: 135:308/330 of query aligns to 40:209/224 of 3v77A
>BPHYT_RS01215 FitnessBrowser__BFirm:BPHYT_RS01215
MREEAAQWWVVVGEHAVALRDLAGDGLLELPSQGTATVDSIYPRLEALIGELSALHSQAF
SHVPRGAWLAVGQLHFLAPVSPAASIYCSAANYRKQLVELIVTRGGDPEIDRLPVGERRP
VAQRMVEKRSRQGEPYFFQRPNSCIAPPDGEIHAESGTEELDWELELGIVIGRRGRHVAR
EDAPNFVAACLILNDVTDRALIYRQDFPGADWLRGKGMPASMPAGPYLVPASVIGEIDAL
RLRLSVNGEVMQDELAGDMILDVPRLIEYLSSRVELRPGDVIATGTPAGTGAERGRFLQD
GDVIRAEIDGLGCQMNKVVFGPGAGPGDRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory