SitesBLAST
Comparing BPHYT_RS01260 FitnessBrowser__BFirm:BPHYT_RS01260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uqvG Methanococcus jannaschii serine hydroxymethyl-transferase in complex with plp (see paper)
38% identity, 96% coverage: 13:372/376 of query aligns to 57:420/429 of 4uqvG
- active site: D196 (= D152), S223 (= S179), K226 (= K182), Q232 (= Q188)
- binding pyridoxal-5'-phosphate: G93 (= G49), V94 (≠ M50), H121 (≠ D77), A198 (= A154), H199 (= H155), S223 (= S179), H225 (≠ G181), K226 (= K182)
Sites not aligning to the query:
4bhdB Methanococcus jannaschii serine hydroxymethyl-transferase, apo form (see paper)
36% identity, 95% coverage: 16:372/376 of query aligns to 45:386/395 of 4bhdB
Sites not aligning to the query:
8suiB Joint x-ray/neutron structure of thermus thermophilus serine hydroxymethyltransferase (tthshmt) in internal aldimine state with l- ser bound in a pre-michalis complex (see paper)
34% identity, 91% coverage: 14:355/376 of query aligns to 54:392/402 of 8suiB
8ssyA Room-temperature x-ray structure of thermus thermophilus serine hydroxymethyltransferase (shmt) bound with d-ser in a pseudo- michaelis complex (see paper)
34% identity, 91% coverage: 14:355/376 of query aligns to 54:392/402 of 8ssyA
Sites not aligning to the query:
2dkjA Crystal structure of t.Th.Hb8 serine hydroxymethyltransferase
34% identity, 91% coverage: 14:355/376 of query aligns to 54:392/402 of 2dkjA
- active site: D192 (= D152), T218 (≠ S179), K221 (= K182), R227 (≠ Q188)
- binding pyridoxal-5'-phosphate: S88 (≠ G48), G89 (= G49), S90 (≠ M50), H117 (≠ D77), S167 (≠ T127), D192 (= D152), A194 (= A154), H220 (≠ G181), K221 (= K182)
Sites not aligning to the query:
Q5SI56 Serine hydroxymethyltransferase; SHMT; Serine methylase; EC 2.1.2.1 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
34% identity, 91% coverage: 14:355/376 of query aligns to 59:397/407 of Q5SI56
- GS 94:95 (≠ GM 49:50) binding
- S172 (≠ T127) binding
- H200 (= H155) binding
- H225 (≠ G181) binding
- K226 (= K182) modified: N6-(pyridoxal phosphate)lysine
- G258 (≠ S214) binding
Sites not aligning to the query:
6ymdA Crystal structure of serine hydroxymethyltransferase from aphanothece halophytica in the covalent complex with malonate (see paper)
30% identity, 93% coverage: 13:362/376 of query aligns to 61:411/420 of 6ymdA
- active site: D200 (= D152), T226 (≠ S179), K229 (= K182), R235 (≠ Q188)
- binding malonate ion: Y64 (≠ F16), H125 (≠ D77), H203 (= H155), K229 (= K182), R361 (= R316)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S96 (≠ G48), G97 (= G49), A98 (≠ M50), H125 (≠ D77), Y174 (≠ M126), S175 (≠ T127), D200 (= D152), A202 (= A154), T226 (≠ S179), K229 (= K182), G261 (≠ S214)
Sites not aligning to the query:
6ymfA Crystal structure of serine hydroxymethyltransferase from aphanothece halophytica in the plp-serine external aldimine state (see paper)
30% identity, 93% coverage: 13:362/376 of query aligns to 61:411/418 of 6ymfA
- active site: D200 (= D152), T226 (≠ S179), K229 (= K182), R235 (≠ Q188)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: S96 (≠ G48), G97 (= G49), A98 (≠ M50), H125 (≠ D77), S175 (≠ T127), D200 (= D152), A202 (= A154), H203 (= H155), T226 (≠ S179), K229 (= K182), R361 (= R316)
Sites not aligning to the query:
2vmyA Crystal structure of f351gbsshmt in complex with gly and fthf (see paper)
32% identity, 92% coverage: 2:347/376 of query aligns to 49:390/405 of 2vmyA
- active site: Y51 (≠ A4), E53 (≠ G6), D197 (= D152), T223 (≠ S179), K226 (= K182), R232 (≠ Q188)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: E53 (≠ G6), Y60 (≠ F15), Y61 (≠ F16), L117 (= L72), G121 (= G76), H122 (≠ D77), L123 (≠ T78), S172 (≠ T127), K248 (≠ E205), F251 (= F208), N341 (≠ M299), S349 (≠ T308), P350 (≠ G309), G351 (= G310), R357 (= R316)
- binding glycine: Y51 (≠ A4), Y61 (≠ F16), H200 (= H155), K226 (= K182), R357 (= R316)
- binding pyridoxal-5'-phosphate: Y51 (≠ A4), S93 (≠ G48), G94 (= G49), A95 (≠ M50), H122 (≠ D77), S172 (≠ T127), D197 (= D152), A199 (= A154), H200 (= H155), T223 (≠ S179), K226 (= K182), G257 (≠ S214)
Sites not aligning to the query:
2vmxA Crystal structure of f351gbsshmt in complex with l-allo-thr (see paper)
32% identity, 92% coverage: 2:347/376 of query aligns to 49:390/405 of 2vmxA
- active site: Y51 (≠ A4), E53 (≠ G6), D197 (= D152), T223 (≠ S179), K226 (= K182), R232 (≠ Q188)
- binding allo-threonine: H122 (≠ D77), H200 (= H155), R357 (= R316)
- binding pyridoxal-5'-phosphate: S93 (≠ G48), G94 (= G49), A95 (≠ M50), H122 (≠ D77), S172 (≠ T127), D197 (= D152), A199 (= A154), H200 (= H155), T223 (≠ S179), K226 (= K182)
Sites not aligning to the query:
1kl2A Crystal structure of serine hydroxymethyltransferase complexed with glycine and 5-formyl tetrahydrofolate (see paper)
32% identity, 92% coverage: 2:347/376 of query aligns to 49:390/405 of 1kl2A
- active site: Y51 (≠ A4), E53 (≠ G6), D197 (= D152), T223 (≠ S179), K226 (= K182), R232 (≠ Q188)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: E53 (≠ G6), Y60 (≠ F15), G121 (= G76), H122 (≠ D77), S172 (≠ T127), F251 (= F208), N341 (≠ M299)
- binding glycine: Y51 (≠ A4), Y61 (≠ F16), H200 (= H155), R357 (= R316)
- binding pyridoxal-5'-phosphate: S93 (≠ G48), G94 (= G49), A95 (≠ M50), H122 (≠ D77), S172 (≠ T127), D197 (= D152), A199 (= A154), H200 (= H155), T223 (≠ S179), H225 (≠ G181), K226 (= K182)
Sites not aligning to the query:
1kl1A Crystal structure of serine hydroxymethyltransferase complexed with glycine (see paper)
32% identity, 92% coverage: 2:347/376 of query aligns to 49:390/405 of 1kl1A
- active site: Y51 (≠ A4), E53 (≠ G6), D197 (= D152), T223 (≠ S179), K226 (= K182), R232 (≠ Q188)
- binding glycine: H122 (≠ D77), R357 (= R316)
- binding pyridoxal-5'-phosphate: S93 (≠ G48), G94 (= G49), A95 (≠ M50), H122 (≠ D77), A171 (≠ M126), S172 (≠ T127), D197 (= D152), A199 (= A154), H200 (= H155), T223 (≠ S179), H225 (≠ G181), K226 (= K182)
Sites not aligning to the query:
1kkpA Crystal structure of serine hydroxymethyltransferase complexed with serine (see paper)
32% identity, 92% coverage: 2:347/376 of query aligns to 49:390/405 of 1kkpA
- active site: Y51 (≠ A4), E53 (≠ G6), D197 (= D152), T223 (≠ S179), K226 (= K182), R232 (≠ Q188)
- binding pyridoxal-5'-phosphate: S93 (≠ G48), G94 (= G49), A95 (≠ M50), H122 (≠ D77), S172 (≠ T127), D197 (= D152), A199 (= A154), H200 (= H155), K226 (= K182)
- binding serine: H122 (≠ D77), R357 (= R316)
Sites not aligning to the query:
1kkjA Crystal structure of serine hydroxymethyltransferase from b.Stearothermophilus (see paper)
32% identity, 92% coverage: 2:347/376 of query aligns to 49:390/405 of 1kkjA
- active site: Y51 (≠ A4), E53 (≠ G6), D197 (= D152), T223 (≠ S179), K226 (= K182), R232 (≠ Q188)
- binding pyridoxal-5'-phosphate: S93 (≠ G48), G94 (= G49), A95 (≠ M50), H122 (≠ D77), S172 (≠ T127), D197 (= D152), A199 (= A154), H200 (= H155), T223 (≠ S179), H225 (≠ G181), K226 (= K182)
7x5oB Crystal structure of e. Faecium shmt in complex with me-thf and plp- gly (see paper)
30% identity, 91% coverage: 13:355/376 of query aligns to 57:397/412 of 7x5oB
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: Y60 (≠ F16), S92 (≠ G48), G93 (= G49), S94 (≠ M50), H121 (≠ N80), S171 (≠ T127), D196 (= D152), A198 (= A154), H199 (= H155), K225 (= K182), R358 (= R316)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: Y59 (≠ F15), L116 (= L72), G119 (= G75), G120 (= G76), H121 (≠ N80), S171 (≠ T127), P252 (= P209), N342 (≠ M299), P351 (≠ T308)
Sites not aligning to the query:
7x5nA Crystal structure of e. Faecium shmt in complex with (+)-shin-1 and plp-ser (see paper)
30% identity, 91% coverage: 13:355/376 of query aligns to 56:396/409 of 7x5nA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: Y58 (≠ F15), Y59 (≠ F16), L115 (= L72), G119 (= G76), H120 (≠ N80), L121 (≠ R81), K340 (≠ E298), N341 (≠ M299), S342 (≠ P300), P350 (≠ T308), F351 (≠ G309), R357 (= R316)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: Y59 (≠ F16), S91 (≠ G48), G92 (= G49), S93 (≠ M50), H120 (≠ N80), S170 (≠ T127), D195 (= D152), A197 (= A154), H198 (= H155), K224 (= K182), R357 (= R316)
Sites not aligning to the query:
7v3dA Complex structure of serine hydroxymethyltransferase from enterococcus faecium and its inhibitor (see paper)
30% identity, 91% coverage: 13:355/376 of query aligns to 56:396/409 of 7v3dA
- binding (4R)-6-azanyl-4-[3-(hydroxymethyl)-5-phenyl-phenyl]-3-methyl-4-propan-2-yl-1H-pyrano[2,3-c]pyrazole-5-carbonitrile: Y58 (≠ F15), L115 (= L72), G119 (= G76), H120 (≠ N80), L121 (≠ R81), K340 (≠ E298), S342 (≠ P300), P350 (≠ T308), F351 (≠ G309), R357 (= R316)
- binding pyridoxal-5'-phosphate: S91 (≠ G48), G92 (= G49), S93 (≠ M50), H120 (≠ N80), S170 (≠ T127), D195 (= D152), A197 (= A154), K224 (= K182), G255 (= G213)
Sites not aligning to the query:
4otlA X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and glycine
31% identity, 93% coverage: 14:362/376 of query aligns to 58:405/409 of 4otlA
- active site: D195 (= D152), T221 (≠ S179), K224 (= K182), R230 (≠ Q188)
- binding glycine: Y60 (≠ F16), H121 (≠ D77), K224 (= K182), R355 (= R316)
- binding pyridoxal-5'-phosphate: S92 (≠ G48), G93 (= G49), S94 (≠ M50), H121 (≠ D77), S170 (≠ T127), D195 (= D152), A197 (= A154), H198 (= H155), K224 (= K182)
Sites not aligning to the query:
4n0wA X-ray crystal structure of a serine hydroxymethyltransferase from burkholderia cenocepacia with covalently attached pyridoxal phosphate
30% identity, 93% coverage: 13:362/376 of query aligns to 64:412/416 of 4n0wA
- active site: D202 (= D152), T228 (≠ S179), K231 (= K182), R237 (≠ Q188)
- binding pyridoxal-5'-phosphate: S99 (≠ G48), G100 (= G49), S101 (≠ M50), H128 (≠ D77), D202 (= D152), A204 (= A154), H205 (= H155), K231 (= K182)
Sites not aligning to the query:
4ot8A X-ray crystal structure of serine hydroxymethyl transferase from burkholderia cenocepacia bound to plp and serine
31% identity, 93% coverage: 14:362/376 of query aligns to 63:410/414 of 4ot8A
- active site: D200 (= D152), T226 (≠ S179), K229 (= K182), R235 (≠ Q188)
- binding pyridoxal-5'-phosphate: S97 (≠ G48), G98 (= G49), S99 (≠ M50), H126 (≠ D77), D200 (= D152), A202 (= A154), H203 (= H155), K229 (= K182)
- binding serine: Y65 (≠ F16), H126 (≠ D77), H203 (= H155), R360 (= R316)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS01260 FitnessBrowser__BFirm:BPHYT_RS01260
GTRASGGHIGRDNRFFAGMRFIDELESLCVELLKKAFRVRYADHRLMGGMAATLVAYTAL
TQPGDRVMTAPLQMGGDTSNRTNGPPGVRGTRVIDIPYSVKDGSINLDEFATIARKERPA
VTGLGMTLTLFPLPIREIKAIVSEWGGLVYFDGAHQLGLISAGLFQDPLGEGADVMTGSS
GKTFSGPQGGIICWNTDRLADTIAETIFPVLTGSHQINRVAALAVAASEMLEYGPVYMRQ
VVANAQALAEFLHDRGINVLYAERGYTQTHQIVVDSRPAGSGRTAVRRLEAANIICNEMP
LPWDSVETGGVETGIRLGTVEVTRRGMGVAEMEWIAERIAKVLHGSEATAIAPEVADFLG
RFDTIYYCHEHGLPPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory