SitesBLAST
Comparing BPHYT_RS02510 FitnessBrowser__BFirm:BPHYT_RS02510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 95% coverage: 5:409/426 of query aligns to 11:423/426 of 6xwnB
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 95% coverage: 5:409/426 of query aligns to 9:421/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 95% coverage: 5:409/426 of query aligns to 11:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S267), S275 (= S268), S276 (= S269), T313 (= T305), G353 (= G345), V354 (= V346), A357 (= A349), G358 (= G350), D394 (≠ S380), R397 (= R383), T398 (≠ A384)
- binding decyl-beta-d-maltopyranoside: L194 (≠ G187), G198 (≠ I191), Y202 (≠ L195)
- binding sodium ion: Y87 (≠ F81), T90 (≠ V84), S91 (= S85), S276 (= S269), G305 (= G297), A306 (≠ Y298), T307 (≠ S299), N309 (= N301), N309 (= N301), M310 (≠ L302), D311 (= D303), S348 (= S340), I349 (≠ K341), G350 (= G342), T351 (≠ A343), N401 (= N387), V402 (≠ I388), D405 (≠ N391)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 95% coverage: 5:409/426 of query aligns to 8:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ G187), G195 (≠ I191), R282 (vs. gap)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S267), S272 (= S268), S273 (= S269), M307 (≠ L302), T310 (= T305), G353 (= G348), A354 (= A349), R394 (= R383), T395 (≠ A384)
Sites not aligning to the query:
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
29% identity, 96% coverage: 1:407/426 of query aligns to 8:421/425 of O59010
- S65 (≠ T56) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S267) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 267:269) binding
- M311 (≠ L302) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T305) binding
- V355 (= V346) binding
- D394 (≠ S380) binding
- M395 (≠ E381) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R383) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N387) binding
- D405 (≠ N391) mutation to N: Strongly decreased affinity for aspartate.
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
30% identity, 95% coverage: 5:409/426 of query aligns to 4:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S267), S265 (= S269), M299 (≠ L302), T302 (= T305), T340 (≠ A343), G342 (= G345), V343 (= V346), G347 (= G350), D383 (≠ S380), R386 (= R383), T387 (≠ A384), N390 (= N387)
- binding decyl-beta-d-maltopyranoside: H23 (= H25), V212 (≠ L216), A216 (≠ L220)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
29% identity, 94% coverage: 4:402/426 of query aligns to 2:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
29% identity, 95% coverage: 1:405/426 of query aligns to 8:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L37), F46 (≠ L37), P75 (≠ D66), L91 (≠ I83), F95 (= F87), L130 (≠ T129), I133 (≠ F132), I159 (≠ L158), Y167 (≠ A162), K196 (≠ G187), G200 (≠ I191), I207 (= I198), F210 (= F201), L250 (≠ I241), I262 (≠ V253), M269 (= M260), T334 (= T325), V335 (≠ W326), G336 (≠ T327), T340 (= T331), L343 (≠ A334), M399 (≠ L385)
- binding aspartic acid: S277 (= S268), S278 (= S269), T314 (= T305), G354 (= G345), A358 (= A349), G359 (= G350), D394 (≠ S380), R397 (= R383), T398 (≠ A384)
- binding sodium ion: Y89 (≠ F81), T92 (≠ V84), S93 (= S85), G306 (= G297), T308 (≠ S299), N310 (= N301), N310 (= N301), M311 (≠ L302), D312 (= D303), S349 (= S340), I350 (≠ K341), T352 (≠ A343), N401 (= N387), V402 (≠ I388), D405 (≠ N391)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
29% identity, 94% coverage: 1:402/426 of query aligns to 5:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G60), V83 (≠ L78), I157 (≠ L159), Y164 (≠ A162), K193 (≠ G187), T305 (≠ S299), I306 (≠ F300), I347 (≠ K341)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L9), M199 (≠ T193), S275 (= S269), T311 (= T305), G356 (= G350), L384 (= L373), D391 (≠ S380), R394 (= R383)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
29% identity, 94% coverage: 2:402/426 of query aligns to 1:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
29% identity, 94% coverage: 2:402/426 of query aligns to 1:408/408 of 6bauA
- binding cysteine: S270 (= S269), M303 (≠ L302), T306 (= T305), A345 (≠ S344), G346 (= G345), V347 (= V346), G351 (= G350), D386 (≠ S380), C389 (≠ R383), T390 (≠ A384), N393 (= N387)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
27% identity, 94% coverage: 2:402/426 of query aligns to 1:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 87% coverage: 38:409/426 of query aligns to 57:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V70), G89 (= G71), G92 (= G74), A95 (= A77), V96 (≠ L78), Y99 (≠ F81), M163 (≠ L158), F167 (≠ A162), F293 (≠ L292), V297 (≠ T296)
- binding aspartic acid: S268 (= S268), S269 (= S269), T306 (= T305), G346 (= G345), I347 (≠ V346), A350 (= A349), G351 (= G350), D380 (≠ S380), R383 (= R383), T384 (≠ A384)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 87% coverage: 38:409/426 of query aligns to 49:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I61), S80 (≠ V70), G81 (= G71), G84 (= G74), Y91 (≠ F81), M156 (≠ L158), F160 (≠ A162), F286 (≠ L292), V290 (≠ T296)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I53), I148 (= I150), S262 (= S269), S263 (≠ E270), A292 (≠ Y298), T293 (≠ S299), M296 (≠ L302), T299 (= T305), G329 (= G342), A336 (= A349), G337 (= G350), D366 (≠ S380), R369 (= R383), N373 (= N387)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
28% identity, 83% coverage: 55:407/426 of query aligns to 60:429/433 of 8cv2A
- binding sodium ion: Y85 (≠ F81), T88 (≠ V84), T89 (≠ S85), G319 (= G297), A320 (≠ Y298), N323 (= N301), N323 (= N301), M324 (≠ L302), D325 (= D303), N408 (= N387), D412 (≠ N391)
6x2zA Heaat3-ofs-asp (see paper)
27% identity, 83% coverage: 56:407/426 of query aligns to 59:416/419 of 6x2zA
- binding aspartic acid: S275 (= S267), S277 (= S269), T314 (= T305), G354 (= G345), V355 (= V346), D388 (≠ S380), R391 (= R383), T392 (≠ A384)
- binding sodium ion: Y83 (≠ F81), T86 (≠ V84), T87 (≠ S85), G306 (= G297), A307 (≠ Y298), T308 (≠ S299), I309 (≠ F300), N310 (= N301), N310 (= N301), M311 (≠ L302), M311 (≠ L302), D312 (= D303), S349 (= S340), I350 (≠ K341), G351 (= G342), A352 (= A343), N395 (= N387), D399 (≠ N391)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
28% identity, 84% coverage: 56:412/426 of query aligns to 61:416/416 of 8cuaA
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
28% identity, 83% coverage: 56:407/426 of query aligns to 65:426/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S269), D398 (≠ S380), R401 (= R383), T402 (≠ A384), N405 (= N387)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (≠ T347), D398 (≠ S380), R401 (= R383), T402 (≠ A384)
- binding cholesterol hemisuccinate: I258 (≠ V237), L419 (≠ W401)
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
28% identity, 83% coverage: 56:407/426 of query aligns to 65:426/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S268), S287 (= S269), T324 (= T305), A358 (≠ T339), G361 (= G342), V365 (= V346), A368 (= A349), T372 (= T353), D398 (≠ S380), R401 (= R383), T402 (≠ A384), N405 (= N387)
- binding cholesterol hemisuccinate: K80 (≠ R72), R84 (≠ K76)
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
28% identity, 82% coverage: 56:404/426 of query aligns to 58:404/406 of 8ctcA
- binding glutamic acid: S268 (= S268), S269 (= S269), M303 (≠ L302), T306 (= T305), G346 (= G345), A350 (= A349), D380 (≠ S380), R383 (= R383)
- binding sodium ion: Y82 (≠ F81), T85 (≠ V84), T86 (≠ S85), S269 (= S269), G298 (= G297), A299 (≠ Y298), T300 (≠ S299), N302 (= N301), N302 (= N301), M303 (≠ L302), D304 (= D303), S341 (= S340), I342 (≠ K341), G343 (= G342), A344 (= A343), N387 (= N387), D391 (≠ N391)
Query Sequence
>BPHYT_RS02510 FitnessBrowser__BFirm:BPHYT_RS02510
MKKPIHKVLYVQVIVAIIIGIALGHFYPNLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG
IAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLIATHVLKPGVGFNIDPATLDGKAVASY
AAKAHGQTTVDFLMHLIPDTLVSAFAQGEILQILLIALLFGAVLATAGEKGKVVTSFIDG
LSHVLFGIVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLIGTFYLTSIVFVVVVLGI
IARAVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMLKLEKLGCSRSVVGLVVPTGYSF
NLDGTNIYMTMAVLFIAQATNTDLTWTQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV
VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLNAALRGDVPI
KEPAGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory