Comparing BPHYT_RS02715 FitnessBrowser__BFirm:BPHYT_RS02715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
82% identity, 89% coverage: 31:270/270 of query aligns to 1:241/241 of 4qhqA
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
53% identity, 89% coverage: 31:269/270 of query aligns to 1:235/235 of 3tqwA
4yahX Crystal structure of the methionine binding protein, metq (see paper)
54% identity, 89% coverage: 32:270/270 of query aligns to 5:243/245 of 4yahX
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
49% identity, 89% coverage: 25:263/270 of query aligns to 1:237/237 of 3k2dA
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
44% identity, 90% coverage: 27:270/270 of query aligns to 29:272/272 of P04846
Sites not aligning to the query:
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
42% identity, 89% coverage: 28:268/270 of query aligns to 4:245/247 of 4ib2A
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
40% identity, 90% coverage: 28:270/270 of query aligns to 2:240/240 of 4oteB
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
41% identity, 87% coverage: 36:269/270 of query aligns to 7:236/240 of 6dzxA
3gxaC Crystal structure of gna1946 (see paper)
41% identity, 87% coverage: 36:269/270 of query aligns to 8:237/244 of 3gxaC
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
35% identity, 89% coverage: 29:267/270 of query aligns to 2:237/240 of 1xs5A
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
42% identity, 86% coverage: 36:268/270 of query aligns to 3:239/255 of 1p99A
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
37% identity, 87% coverage: 31:264/270 of query aligns to 12:254/260 of 6jf1A
Sites not aligning to the query:
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
37% identity, 90% coverage: 29:270/270 of query aligns to 1:242/242 of 4ntlA
>BPHYT_RS02715 FitnessBrowser__BFirm:BPHYT_RS02715
MQRRNILKALSAVIATTAIFTSFGAHADDKVIKVGTIGGPDAQIWEVVTKVAKREGLNVK
VVEFNDYVQPNAALDAGDLDANSFQHQPYLDSQIKQRGYKIVNAGLTYISPLGIYSKKLK
SLKDLPQGAKVAVPNDPSNENRALLLLQTQGVLKLKTGAGTNGNNATALDVADNPKKIKL
VELDAAQLPRSLSDVDAAAINTNFALAAGLQPTKDAIALEDVHSPYANLIAVRTQDKDKP
WVKKLVAAYQSEDVRQFIKTQFKGSVVPSF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory