Comparing BPHYT_RS02740 BPHYT_RS02740 PTS glucose transporter subunit IIA to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
36% identity, 64% coverage: 293:836/854 of query aligns to 1:553/572 of 2hwgA
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 64% coverage: 293:836/854 of query aligns to 2:554/575 of P08839
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
34% identity, 65% coverage: 293:843/854 of query aligns to 5:562/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
35% identity, 62% coverage: 293:818/854 of query aligns to 4:535/570 of 2wqdA
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
43% identity, 35% coverage: 548:850/854 of query aligns to 13:320/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
43% identity, 35% coverage: 548:850/854 of query aligns to 6:313/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
29% identity, 44% coverage: 441:813/854 of query aligns to 423:841/850 of 5lu4A
Sites not aligning to the query:
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
28% identity, 44% coverage: 441:813/854 of query aligns to 350:786/797 of 5jvjB
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
28% identity, 44% coverage: 441:813/854 of query aligns to 423:863/874 of 5jvlA
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
28% identity, 44% coverage: 441:813/854 of query aligns to 502:942/953 of Q39735
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
28% identity, 43% coverage: 443:813/854 of query aligns to 498:936/947 of P11155
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
28% identity, 43% coverage: 443:813/854 of query aligns to 425:863/874 of 1vbgA
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
27% identity, 44% coverage: 441:813/854 of query aligns to 421:859/872 of 1kc7A
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
27% identity, 44% coverage: 441:813/854 of query aligns to 422:860/874 of P22983
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 43% coverage: 444:813/854 of query aligns to 515:951/963 of O23404
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
28% identity, 41% coverage: 461:812/854 of query aligns to 403:777/791 of Q02KR1
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
28% identity, 43% coverage: 450:813/854 of query aligns to 104:509/520 of 5jvlB
Sites not aligning to the query:
1vbhA Pyruvate phosphate dikinase with bound mg-pep from maize (see paper)
29% identity, 40% coverage: 474:813/854 of query aligns to 442:851/862 of 1vbhA
Sites not aligning to the query:
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
42% identity, 17% coverage: 10:156/854 of query aligns to 501:647/648 of P09323
Sites not aligning to the query:
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
38% identity, 18% coverage: 6:156/854 of query aligns to 19:168/169 of P69783
Sites not aligning to the query:
>BPHYT_RS02740 BPHYT_RS02740 PTS glucose transporter subunit IIA
MSHSEGHIVLLAPMTGPVVPLANVPDPVFSGGMFGDGIGVDPLEGRLVAPCDATVTHLAR
TGHAVTLATAEGAEILLHIGIDTVELNGKGFAPMVAQGAHVRAGDVLIEFDQDQVALNAP
SLVSVIAIANSDAFEIVERVQGGLLKAGETPLLVLRARDGAAAEASRQLSSTNVTEEARQ
QVTLVHAGGLHARPAARAREAARGFDARVEVRYEGRKAAIESVVGLLGLGAGEGATVELL
GMGPQAAAAVAAIANELTREAHGEVEEKPARQSSPAPQAVARPAGETLAPNTLAGVCAAP
GVAVGKLVRWDDADIDPPEKANGTSAAESRLLDKAIATVDADLDTTVRDASQRGAVGEAG
IFSVHRVLLEDPTLLDAARDLISLGKSAGFAWREAIRAQIAILTNIEDALLAERAADLRD
IEKRVLRALGYTSATARTLPEEAVLAAEEFTPSDLSTLDRSRVTALVMARGGATSHAAIL
ARQAGIPALVAVGDALHAIPEGTQVVVNATTGRLEFAPTELDVERARLERTRLADVREAN
RRTSQQAAVTSDGRAIEVAANIATLDDAKTAVENGADSVGLLRTELLFIHRAAAPTTDEH
RQSYQAIVDALSGRTAIIRTLDVGADKEVDYLTLPPEPNPALGLRGIRLAQVRPDLLDDQ
LRGLLAVQPLGAVRILLPMVTDVGELIRIRKRIDEFARELGRTEPIEVGVMIEVPSAALL
ADQLAQHADFLSIGTNDLTQYTLAMDRCQADLAAQADGLHPAVLRLIAATVQGADKHGKW
VGVCGALAGDPLAMPLLVGLGVTELSVDPVSVPGIKARVRNLDYQLCRQRAQDALALESA
QAVRAASRETWPLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory