Comparing BPHYT_RS02790 FitnessBrowser__BFirm:BPHYT_RS02790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
58% identity, 96% coverage: 5:339/348 of query aligns to 25:363/573 of 3hq1A
1sr9A Crystal structure of leua from mycobacterium tuberculosis (see paper)
58% identity, 96% coverage: 5:339/348 of query aligns to 25:363/573 of 1sr9A
P9WQB3 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
58% identity, 96% coverage: 5:339/348 of query aligns to 42:380/644 of P9WQB3
Sites not aligning to the query:
3hpsA Crystal structure of mycobacterium tuberculosis leua complexed with ketoisocaproate (kic)
58% identity, 96% coverage: 5:339/348 of query aligns to 25:363/575 of 3hpsA
Sites not aligning to the query:
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
58% identity, 96% coverage: 5:339/348 of query aligns to 25:363/576 of 3hpzB
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
58% identity, 96% coverage: 5:339/348 of query aligns to 25:363/577 of 3figB
Sites not aligning to the query:
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
28% identity, 87% coverage: 38:339/348 of query aligns to 11:300/379 of 4ov4A
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
28% identity, 87% coverage: 38:339/348 of query aligns to 11:300/380 of 4ov9A
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 85% coverage: 34:328/348 of query aligns to 88:382/503 of Q9FN52
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
27% identity, 85% coverage: 32:327/348 of query aligns to 5:288/308 of 3rmjB
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
27% identity, 85% coverage: 32:327/348 of query aligns to 8:291/517 of Q9JZG1
Sites not aligning to the query:
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 88% coverage: 21:327/348 of query aligns to 70:381/506 of Q9FG67
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
22% identity, 88% coverage: 21:327/348 of query aligns to 3:314/409 of 6e1jA
Sites not aligning to the query:
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
24% identity, 85% coverage: 34:328/348 of query aligns to 25:300/399 of 6ktqA
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
27% identity, 75% coverage: 20:279/348 of query aligns to 2:224/314 of 2zyfA
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
27% identity, 75% coverage: 20:279/348 of query aligns to 1:223/347 of 3a9iA
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
27% identity, 75% coverage: 20:279/348 of query aligns to 2:222/312 of 2ztjA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
27% identity, 75% coverage: 20:279/348 of query aligns to 2:230/376 of O87198
>BPHYT_RS02790 FitnessBrowser__BFirm:BPHYT_RS02790
MLQNPAEKYRPFPAVRLTGRKWPSRTIDQTPVWMSTDLRDGNQALIEPMNAAQKLEFFEM
LVAIGFKEIEVGYPSASQMDFDFVRKLIEEKRIPDDVTIEVFMPSRAELIARTFEALEGA
PRAIVHLYNAICPSFRRIVFNQTKAEIKALAVHGTQIIKEHAQARPGTHWTFQYSPETFN
ATELPFAREVCDAVAQTWRPTRDHKMIVNLPASVEAATPNVFADQIEWMHRNLGYRDSIV
LSVHPHNDRGTAVAAAELALLAGADRVEGCLFGNGERTGNVDLVALAMNLAAQGVDTGLD
FSNMEAVRRVVERCNQLPVHPRHPYAGEAMMRAKNAERQGVAAQEPIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory