SitesBLAST
Comparing BPHYT_RS03145 FitnessBrowser__BFirm:BPHYT_RS03145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
53% identity, 99% coverage: 5:507/507 of query aligns to 15:513/514 of P04968
- K62 (= K52) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N79) binding
- GGGGL 188:192 (= GGGGL 182:186) binding
- S315 (= S309) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
52% identity, 99% coverage: 5:507/507 of query aligns to 11:493/494 of 1tdjA
- active site: K58 (= K52), A83 (= A77), E209 (≠ Q207), S213 (= S211), C215 (≠ A213), G237 (= G235), L310 (≠ T308), S311 (= S309)
- binding pyridoxal-5'-phosphate: F57 (= F51), K58 (= K52), N85 (= N79), G184 (= G182), G185 (= G183), G186 (= G184), G187 (= G185), G237 (= G235), E282 (= E280), S311 (= S309), G312 (= G310)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
37% identity, 61% coverage: 8:318/507 of query aligns to 16:318/326 of 2gn2A
- active site: K56 (= K52), A81 (= A77), Q207 (= Q207), V211 (≠ S211), G213 (≠ A213), G235 (= G235), I308 (≠ T308), S309 (= S309)
- binding cytidine-5'-monophosphate: R51 (≠ P47), T52 (≠ V48), G53 (≠ F49), A114 (= A110), D117 (≠ A113), Y118 (≠ H114), N312 (= N312)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
33% identity, 60% coverage: 12:317/507 of query aligns to 12:311/318 of 1wtcA
- active site: K52 (= K52), S77 (≠ A77), E203 (≠ Q207), G207 (≠ S211), D209 (≠ A213), G231 (= G235), I302 (≠ T308), S303 (= S309)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ R20), K47 (≠ P47), M48 (≠ V48), A109 (≠ D109), A110 (= A110), Y114 (≠ H114)
- binding magnesium ion: E203 (≠ Q207), G207 (≠ S211), D209 (≠ A213)
- binding pyridoxal-5'-phosphate: F51 (= F51), K52 (= K52), N79 (= N79), G178 (= G182), G179 (= G183), G180 (= G184), G181 (= G185), G231 (= G235), E276 (= E280), T278 (≠ A282), S303 (= S309)
1v71A Crystal structure of s.Pombe serine racemase
33% identity, 60% coverage: 12:317/507 of query aligns to 12:311/318 of 1v71A
- active site: K52 (= K52), S77 (≠ A77), E203 (≠ Q207), G207 (≠ S211), D209 (≠ A213), G231 (= G235), I302 (≠ T308), S303 (= S309)
- binding magnesium ion: E203 (≠ Q207), G207 (≠ S211), D209 (≠ A213)
- binding pyridoxal-5'-phosphate: F51 (= F51), K52 (= K52), N79 (= N79), G178 (= G182), G179 (= G183), G180 (= G184), G181 (= G185), G231 (= G235), E276 (= E280), T278 (≠ A282), S303 (= S309), G304 (= G310)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 60% coverage: 12:317/507 of query aligns to 17:316/323 of O59791
- S82 (≠ A77) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
33% identity, 60% coverage: 12:317/507 of query aligns to 13:312/319 of 2zr8A
- active site: K53 (= K52), S78 (≠ A77), E204 (≠ Q207), G208 (≠ S211), D210 (≠ A213), G232 (= G235), I303 (≠ T308), S304 (= S309)
- binding magnesium ion: E204 (≠ Q207), G208 (≠ S211), D210 (≠ A213)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F51), K53 (= K52), S77 (= S76), S78 (≠ A77), N80 (= N79), H81 (= H80), P147 (= P149), G179 (= G182), G180 (= G183), G181 (= G184), G182 (= G185), G232 (= G235), E277 (= E280), T279 (≠ A282), S304 (= S309)
- binding serine: S78 (≠ A77), R129 (≠ Y132), D231 (= D234), G232 (= G235), A233 (≠ T236), Q234 (≠ A237), T235 (≠ V238)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
33% identity, 60% coverage: 12:317/507 of query aligns to 13:312/319 of 2zpuA
- active site: K53 (= K52), S78 (≠ A77), E204 (≠ Q207), G208 (≠ S211), D210 (≠ A213), G232 (= G235), I303 (≠ T308), S304 (= S309)
- binding magnesium ion: E204 (≠ Q207), G208 (≠ S211), D210 (≠ A213)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F51), K53 (= K52), S77 (= S76), S78 (≠ A77), N80 (= N79), H81 (= H80), P147 (= P149), G179 (= G182), G180 (= G183), G181 (= G184), G182 (= G185), G232 (= G235), E277 (= E280), T279 (≠ A282), S304 (= S309)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
31% identity, 60% coverage: 13:315/507 of query aligns to 29:329/339 of Q7XSN8
- E219 (≠ Q207) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A213) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
33% identity, 55% coverage: 35:315/507 of query aligns to 37:316/320 of 7nbhAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211), G236 (= G235), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A77), G85 (≠ A81), Q86 (= Q82), K111 (= K107), I115 (≠ V111), Y118 (≠ H114), D235 (= D234), P281 (= P281), N313 (= N312), V314 (≠ M313), D315 (≠ N314)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 55% coverage: 35:315/507 of query aligns to 37:316/322 of 7nbgAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211), G236 (= G235), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ T236), T282 (≠ A282), S310 (= S309), G311 (= G310)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A77), G85 (≠ A81), Q86 (= Q82), I101 (= I97), K111 (= K107), I115 (≠ V111), Y118 (≠ H114)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
33% identity, 55% coverage: 35:315/507 of query aligns to 37:316/323 of 7nbfAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211), G236 (= G235), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211)
- binding magnesium ion: N244 (≠ E244)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ T236), T282 (≠ A282), S310 (= S309), G311 (= G310)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: F46 (≠ N45)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
33% identity, 55% coverage: 35:315/507 of query aligns to 37:316/323 of 7nbdAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211), G236 (= G235), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F272), L278 (≠ V278), V314 (≠ M313), L316 (≠ F315)
- binding magnesium ion: N244 (≠ E244)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ T236), E280 (= E280), T282 (≠ A282), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 55% coverage: 35:315/507 of query aligns to 37:316/323 of 7nbcCCC
- active site: K53 (= K52), S81 (≠ A77), E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211), G236 (= G235), L309 (≠ T308), S310 (= S309)
- binding biphenyl-4-ylacetic acid: T78 (= T74), H79 (≠ A75), H84 (= H80), V148 (= V147), H149 (= H148), P150 (= P149)
- binding calcium ion: E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ T236), T282 (≠ A282), S310 (= S309), G311 (= G310)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 55% coverage: 35:315/507 of query aligns to 37:316/323 of 7nbcAAA
- active site: K53 (= K52), S81 (≠ A77), E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211), G236 (= G235), L309 (≠ T308), S310 (= S309)
- binding calcium ion: E207 (≠ Q207), A211 (vs. gap), D213 (≠ S211)
- binding magnesium ion: N244 (≠ E244)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ T236), T282 (≠ A282), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
40% identity, 54% coverage: 43:316/507 of query aligns to 41:307/308 of 1ve5A
- active site: K50 (= K52), S56 (≠ N58), S72 (≠ A77), E200 (≠ Q207), A204 (≠ S211), D206 (≠ A213), G229 (= G235), L299 (≠ T308), S300 (= S309)
- binding calcium ion: E200 (≠ Q207), A204 (≠ S211), D206 (≠ A213)
- binding pyridoxal-5'-phosphate: F49 (= F51), K50 (= K52), N74 (= N79), G175 (= G182), G176 (= G183), G177 (= G184), G178 (= G185), E274 (= E280), T276 (≠ A282), S300 (= S309), G301 (= G310)
6zspAAA serine racemase bound to atp and malonate. (see paper)
32% identity, 58% coverage: 35:326/507 of query aligns to 37:320/320 of 6zspAAA
- active site: K53 (= K52), S74 (≠ A77), E200 (≠ Q207), A204 (vs. gap), D206 (≠ S211), G229 (= G235), L302 (≠ T308), S303 (= S309)
- binding adenosine-5'-triphosphate: K48 (≠ P47), T49 (≠ V48), Q79 (= Q82), Y111 (≠ H114), E266 (≠ Q273), R267 (≠ D274), K269 (≠ R276), N306 (= N312)
- binding magnesium ion: E200 (≠ Q207), A204 (vs. gap), D206 (≠ S211)
- binding malonate ion: K53 (= K52), S73 (= S76), S74 (≠ A77), N76 (= N79), H77 (= H80), R125 (≠ Y132), G229 (= G235), S232 (≠ V238)
Sites not aligning to the query:
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
30% identity, 62% coverage: 4:317/507 of query aligns to 7:312/319 of A4F2N8
- K53 (= K52) mutation to A: Loss of enzymatic activity.
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
32% identity, 55% coverage: 35:315/507 of query aligns to 38:312/322 of 3l6bA
- active site: K54 (= K52), S77 (≠ A77), E203 (≠ Q207), A207 (vs. gap), D209 (≠ S211), G232 (= G235), T278 (≠ A282), L305 (≠ T308), S306 (= S309)
- binding malonate ion: K54 (= K52), S76 (= S76), S77 (≠ A77), N79 (= N79), H80 (= H80), R128 (≠ Y132), G232 (= G235)
- binding manganese (ii) ion: E203 (≠ Q207), A207 (vs. gap), D209 (≠ S211)
- binding pyridoxal-5'-phosphate: F53 (= F51), K54 (= K52), N79 (= N79), G178 (= G182), G179 (= G183), G180 (= G184), G181 (= G185), M182 (≠ L186), V233 (≠ T236), E276 (= E280), T278 (≠ A282), S306 (= S309), G307 (= G310)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
32% identity, 55% coverage: 35:314/507 of query aligns to 37:310/310 of 7nbgDDD
- active site: K53 (= K52), S76 (≠ A77), E202 (≠ Q207), A206 (vs. gap), D208 (≠ S211), G231 (= G235), L304 (≠ T308), S305 (= S309)
- binding calcium ion: E202 (≠ Q207), A206 (vs. gap), D208 (≠ S211)
- binding magnesium ion: N239 (≠ E244)
- binding ortho-xylene: S76 (≠ A77), Q81 (= Q82), I96 (= I97), Y113 (≠ H114)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N78 (= N79), G177 (= G182), G178 (= G183), G179 (= G184), G180 (= G185), M181 (≠ L186), G231 (= G235), V232 (≠ T236), E275 (= E280), T277 (≠ A282), S305 (= S309), G306 (= G310)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS03145 FitnessBrowser__BFirm:BPHYT_RS03145
MASHDYLKKTLTARVYDVARETELERAPNLSARLRNPVYLKREDNQPVFSFKVRGAYNKM
AHISAEALERGVITASAGNHAQGVALSAARMGVKAIIVVPVTTPQVKVDAVRAHGGPTVE
VVQFGESYSDAYEHAVKLQKERDLTFVHPFDDPYVIAGQGTVAMEILSQHQGPIHAIFVP
IGGGGLAAGVAAYVKSVRPEIKVIGVQTDDSCAMAASLKAGERVTLNEVGLFSDGTAVKL
VGEETFRLCSEYLDDVLLVNTDALCAAIKDVFQDTRSVLEPAGSLAVAGAKQYAEREGIE
NQTLIAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFRRFCELVGTRSVTE
FNYRIADANSAHIFVGVQIRNRSESAQIAGAFEAHGFATVDLTFDELSKQHIRYMVGGRS
PLAHDERLFRFEFPERPGALMKFLSSMAPNWNISLFHYRNQGADYSSILVGIQVPDSENE
AFNKFLATLGYPNWEETQNPVYRLFLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory