Comparing BPHYT_RS03320 FitnessBrowser__BFirm:BPHYT_RS03320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
65% identity, 99% coverage: 1:127/128 of query aligns to 1:127/135 of P0AC81
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
64% identity, 98% coverage: 1:126/128 of query aligns to 1:126/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
64% identity, 98% coverage: 1:126/128 of query aligns to 1:126/128 of 1fa5A
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
61% identity, 98% coverage: 1:126/128 of query aligns to 1:126/128 of 4mttA
6bnnA Crystal structure of v278e-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 (see paper)
54% identity, 98% coverage: 2:126/128 of query aligns to 16:140/282 of 6bnnA
Sites not aligning to the query:
5d7zA Crystal structure of glyoxalase i from zea mays (see paper)
54% identity, 98% coverage: 2:126/128 of query aligns to 10:134/281 of 5d7zA
Sites not aligning to the query:
Q948T6 Lactoylglutathione lyase; Aldoketomutase; Allergen Glb33; Glyoxalase I; Glx I; Glyoxylase I 11; OsGLYI-11; OsGLYI11; Ketone-aldehyde mutase; Methylglyoxalase; PP33; S-D-lactoylglutathione methylglyoxal lyase; Allergen Ory s Glyoxalase I; EC 4.4.1.5 from Oryza sativa subsp. japonica (Rice) (see paper)
53% identity, 98% coverage: 2:126/128 of query aligns to 24:149/291 of Q948T6
Sites not aligning to the query:
2c21A Specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme (see paper)
46% identity, 98% coverage: 2:127/128 of query aligns to 3:123/139 of 2c21A
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
38% identity, 98% coverage: 3:128/128 of query aligns to 32:179/184 of Q04760
Sites not aligning to the query:
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
38% identity, 98% coverage: 3:128/128 of query aligns to 24:171/176 of 3w0tA
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
38% identity, 98% coverage: 3:128/128 of query aligns to 24:171/176 of 3vw9A
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
38% identity, 98% coverage: 3:128/128 of query aligns to 24:171/176 of 1qipA
Sites not aligning to the query:
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
38% identity, 98% coverage: 3:128/128 of query aligns to 24:171/176 of 1qinA
Sites not aligning to the query:
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
38% identity, 98% coverage: 3:128/128 of query aligns to 24:171/176 of 1froA
Sites not aligning to the query:
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
38% identity, 98% coverage: 3:128/128 of query aligns to 31:178/185 of 7wt0A
Sites not aligning to the query:
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
38% identity, 98% coverage: 3:128/128 of query aligns to 24:171/175 of 3w0uA
Sites not aligning to the query:
Q9CPU0 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Mus musculus (Mouse) (see paper)
38% identity, 98% coverage: 3:128/128 of query aligns to 32:179/184 of Q9CPU0
4kykA Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
38% identity, 98% coverage: 3:128/128 of query aligns to 27:174/179 of 4kykA
6l0uB Crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor
38% identity, 98% coverage: 3:128/128 of query aligns to 25:172/177 of 6l0uB
4kykB Crystal structure of mouse glyoxalase i complexed with indomethacin (see paper)
38% identity, 98% coverage: 3:128/128 of query aligns to 25:172/177 of 4kykB
>BPHYT_RS03320 FitnessBrowser__BFirm:BPHYT_RS03320
MRLLHTMLRVGDLDRSIAFYTELLGMKLLRRENYPDGKFTLAFVGYEDERDGTVIELTHN
WDTPSYDLGTGFGHLAIEMEDAYAACEKIKAQGGTVVREAGPMKHGTTVIAFVTDPDGYK
IEFIQKKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory