SitesBLAST
Comparing BPHYT_RS03515 FitnessBrowser__BFirm:BPHYT_RS03515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R330), H369 (= H381), H376 (= H388), H414 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E413 (= E425), H414 (= H426), N450 (= N462)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E425)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (= E44), P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W323 (≠ Y334), E414 (= E425), H415 (= H426), N451 (= N462)
- binding manganese (ii) ion: H370 (= H381), H377 (= H388), E414 (= E425)
- binding pyruvic acid: R319 (= R330), H370 (= H381), H377 (= H388), H415 (= H426)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R330), W322 (≠ Y334), H369 (= H381), H376 (= H388), H414 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E413 (= E425), N450 (= N462)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E425)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
52% identity, 96% coverage: 17:467/471 of query aligns to 4:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E413 (= E425), H414 (= H426), N450 (= N462)
- binding lactic acid: R318 (= R330), H369 (= H381), H376 (= H388), H414 (= H426)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E425)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), Y324 (≠ F335), H370 (= H381), E414 (= E425), N451 (= N462)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R330), W323 (≠ Y334), H415 (= H426)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R330), W323 (≠ Y334), H370 (= H381), H415 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), H370 (= H381), E414 (= E425), N451 (= N462)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R330), W323 (≠ Y334), H415 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), Y324 (≠ F335), H370 (= H381), E414 (= E425), N451 (= N462)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), H370 (= H381), E414 (= E425), N451 (= N462)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R330), W323 (≠ Y334), H415 (= H426)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), H370 (= H381), E414 (= E425), N451 (= N462)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R330), H415 (= H426)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), Y324 (≠ F335), H370 (= H381), E414 (= E425), N451 (= N462)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L87), R319 (= R330), W323 (≠ Y334), H415 (= H426)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (= E44), P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E413 (= E425), H414 (= H426), N450 (= N462)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R330), H369 (= H381), H376 (= H388), H414 (= H426)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E413 (= E425)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
52% identity, 96% coverage: 17:467/471 of query aligns to 4:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L87), R317 (= R330), W321 (≠ Y334), H368 (= H381), H375 (= H388), H413 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W321 (≠ Y334), Y322 (≠ F335), E412 (= E425), H413 (= H426), N449 (= N462)
- binding manganese (ii) ion: H368 (= H381), H375 (= H388), E412 (= E425)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R330), W322 (≠ Y334), H369 (= H381), H376 (= H388), H413 (= H426)
- binding flavin-adenine dinucleotide: E32 (= E44), P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), W322 (≠ Y334), E412 (= E425), H413 (= H426), N449 (= N462)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E425)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
53% identity, 96% coverage: 17:467/471 of query aligns to 4:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R330), W322 (≠ Y334), S336 (≠ T348), H369 (= H381), H376 (= H388), H413 (= H426)
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), E412 (= E425), N449 (= N462)
- binding manganese (ii) ion: H369 (= H381), H376 (= H388), E412 (= E425)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
52% identity, 96% coverage: 17:467/471 of query aligns to 4:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P80), G70 (= G82), T71 (≠ N83), G72 (= G84), T73 (≠ S85), G74 (≠ S86), G78 (≠ H90), V79 (≠ L91), L90 (= L102), P132 (= P144), G133 (= G145), A134 (= A146), G140 (= G152), M141 (= M153), A143 (= A155), T144 (= T156), A146 (= A158), S147 (= S159), E200 (= E209), G201 (= G210), I206 (= I215), H369 (= H381), E413 (= E425), N450 (= N462)
- binding deaminohydroxyvaline: R319 (= R330), H414 (= H426)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 94% coverage: 27:470/471 of query aligns to 20:467/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P80), G75 (= G82), S76 (≠ N83), G77 (= G84), T78 (≠ S85), G79 (≠ S86), L80 (= L87), A83 (≠ H90), C84 (≠ L91), P137 (= P144), G138 (= G145), E139 (vs. gap), A142 (= A148), T143 (≠ S149), G146 (= G152), N147 (≠ M153), S149 (≠ A155), T150 (= T156), A152 (= A158), G153 (≠ S159), E203 (= E209), G204 (= G210), I209 (= I215), E422 (= E425), H423 (= H426)
- binding fe (iii) ion: H377 (= H381), H384 (= H388), E422 (= E425)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 89% coverage: 49:467/471 of query aligns to 37:456/459 of P9WIT1
- K354 (≠ E360) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
31% identity, 86% coverage: 60:466/471 of query aligns to 49:464/465 of 3pm9A
- active site: A149 (= A158), L159 (≠ T168)
- binding flavin-adenine dinucleotide: P69 (= P80), Q70 (≠ Y81), G71 (= G82), G72 (≠ N83), N73 (≠ G84), T74 (≠ S85), G75 (≠ S86), L76 (= L87), G79 (≠ H90), Q80 (≠ L91), L91 (= L102), L133 (≠ P144), G134 (= G145), A135 (= A146), C139 (vs. gap), T140 (vs. gap), G142 (= G151), G143 (= G152), S146 (≠ A155), T147 (= T156), A149 (= A158), G150 (≠ S159), E200 (= E209), G201 (= G210), I205 (≠ V214), I206 (= I215), E423 (= E425)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
30% identity, 87% coverage: 59:467/471 of query aligns to 54:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R330), T337 (≠ Y334), K348 (≠ T348), Y379 (≠ V379), H381 (= H381), H388 (= H388), H423 (= H426)
- binding flavin-adenine dinucleotide: P75 (= P80), Q76 (≠ Y81), G77 (= G82), G78 (≠ N83), N79 (≠ G84), T80 (≠ S85), G81 (≠ S86), M82 (≠ L87), G85 (≠ H90), S86 (≠ L91), L139 (≠ P144), G140 (= G145), A141 (= A146), C145 (vs. gap), G149 (= G152), N150 (≠ M153), A152 (= A155), T153 (= T156), G157 (= G160), G207 (= G210), I212 (= I215), E422 (= E425), N459 (= N462)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E425)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
30% identity, 87% coverage: 59:467/471 of query aligns to 54:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P80), G77 (= G82), G78 (≠ N83), N79 (≠ G84), T80 (≠ S85), G81 (≠ S86), G85 (≠ H90), S86 (≠ L91), L139 (≠ P144), G140 (= G145), A141 (= A146), C145 (vs. gap), H146 (vs. gap), G148 (= G151), G149 (= G152), N150 (≠ M153), A152 (= A155), T153 (= T156), A155 (= A158), E206 (= E209), G207 (= G210), I211 (≠ V214), I212 (= I215), E422 (= E425), N459 (= N462)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R330), T337 (≠ Y334), K348 (≠ T348), Y379 (≠ V379), H381 (= H381), H388 (= H388), H423 (= H426)
- binding zinc ion: H381 (= H381), H388 (= H388), E422 (= E425)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS03515 FitnessBrowser__BFirm:BPHYT_RS03515
MNHPVPPAPLRRPFPAELLNALKAAFADRVSVSEVVRTHHGRDESPFDPQLPDAVVFART
TEDVQTIVKLCGQYNVPIIPYGNGSSLEGHLLAVQGGVSIDLSEMNRVLSINAEDLTVTV
EPGISRKQLNEALRDTGLFFPIDPGADASIGGMSATRASGTNAVRYGTMRENVLGLTVVL
ADGRVIKTGTRARKSSAGYDLTRMFVGSEGTLGVITEITVRLYPQPEAVSAAVCAFPSMG
AAVRAVIETIQMGVPIARVEFVDSLAIRSINRHSNLTLREAPTLFFEFHGTEAGVKEQAE
LVQEIAAQNAGEGFEWATRPEDRSRLWNARHNAYFAMLQLKPGCRAVTTDVCVPISRLAE
CVEETEQDLQASPLPCPIVGHVGDGNFHVAILIDPNKPEELVEAERLNHRIVQRALRMDG
TCTGEHGVGLHKMGFLLEEHGEVAVDTMRSIKHALDPHNLMNPGKIFTWAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory