Comparing BPHYT_RS03600 FitnessBrowser__BFirm:BPHYT_RS03600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
41% identity, 46% coverage: 129:420/638 of query aligns to 364:630/632 of 8hx9A
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
42% identity, 45% coverage: 129:414/638 of query aligns to 403:663/673 of 8hx8A
Sites not aligning to the query:
7pi1DDD Aminodeoxychorismate synthase component 1
37% identity, 48% coverage: 109:414/638 of query aligns to 169:446/459 of 7pi1DDD
Sites not aligning to the query:
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
38% identity, 46% coverage: 119:414/638 of query aligns to 186:453/470 of P28820
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
37% identity, 48% coverage: 101:409/638 of query aligns to 155:439/453 of P05041
Sites not aligning to the query:
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
35% identity, 48% coverage: 101:409/638 of query aligns to 153:423/437 of 1k0eA
Sites not aligning to the query:
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 46% coverage: 130:420/638 of query aligns to 302:584/595 of P32068
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
33% identity, 47% coverage: 124:420/638 of query aligns to 278:566/577 of Q94GF1
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
32% identity, 44% coverage: 136:414/638 of query aligns to 229:483/499 of 7bvdA
Sites not aligning to the query:
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 44% coverage: 136:414/638 of query aligns to 250:508/524 of A0QX93
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 48% coverage: 129:435/638 of query aligns to 207:485/489 of O94582
Sites not aligning to the query:
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
33% identity, 45% coverage: 129:414/638 of query aligns to 222:487/505 of 5cwaA
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
32% identity, 48% coverage: 101:409/638 of query aligns to 155:406/420 of 1k0gA
Sites not aligning to the query:
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
32% identity, 48% coverage: 101:409/638 of query aligns to 155:403/415 of 1k0gB
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
32% identity, 44% coverage: 137:414/638 of query aligns to 245:503/520 of P00898
Sites not aligning to the query:
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
32% identity, 44% coverage: 137:414/638 of query aligns to 241:499/512 of 1i1qA
Sites not aligning to the query:
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
30% identity, 45% coverage: 125:414/638 of query aligns to 224:494/511 of 1i7sA
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
30% identity, 45% coverage: 125:414/638 of query aligns to 230:500/517 of 1i7qA
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
30% identity, 45% coverage: 125:414/638 of query aligns to 232:502/519 of P00897
Sites not aligning to the query:
3st6A Structure of a m. Tuberculosis synthase, mbti, in complex with an isochorismate analogue inhibitor (see paper)
29% identity, 35% coverage: 122:344/638 of query aligns to 158:380/436 of 3st6A
Sites not aligning to the query:
>BPHYT_RS03600 FitnessBrowser__BFirm:BPHYT_RS03600
MTADERGAVFALLDDCDATAARRSSRLYTGFVQERVCAHAAQLEAVCETVAAQMQRGLHA
VVLADYEFGRHLLDGDLNRSLKTQRGDATLRFLLFERCENLSREEVDAWLMARDEGAAEP
SVAGTMNVRASVDPAEFNAAIDAIHSALRAGDSYQVNYTYRLGFDVFGSPTALYRRLRAR
QPVPYGALIALPGRQWVLSCSPELFIEKQGATLRARPMKGTAPRSDDPAVDRRAAEFLGN
DPKNRAENVMIVDLLRNDLSRVAQTGSVKVPALFSVEPYASVWQMTSTVEAALKPATSFA
QTLRALFPCGSITGAPKHRTMQLIDELESTPRGLYTGAIGWLDAPSSSADTADATTCDAN
HTACGDFCLSVAIRTLTLGPSTQTGHLEGKMGVGAGIVLDSVAADEYAECQLKASFLTGA
EPGFELFETMYATREEGVRHLSRHLARLSSSAATLGFKFDDANAIAAAIAVKCASLPAQT
PHRMRLALSKNGTIQITVAVLTPLAESIVGVLLGPDHAFPATDAADPLLHHKTTRRAEYD
RGWREAEAKGAFDTLFFNAQGELTEGGRSNVFVKLAGRWWTPPLASGVLPGVMRSVLLEE
ALELQAGERVLTRTDLLNAEALMVCNALRGAVLARIVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory