Comparing BPHYT_RS03930 FitnessBrowser__BFirm:BPHYT_RS03930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
39% identity, 94% coverage: 1:304/325 of query aligns to 1:296/305 of 6ndsA
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
36% identity, 90% coverage: 1:291/325 of query aligns to 26:310/325 of P35914
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
36% identity, 89% coverage: 4:291/325 of query aligns to 2:283/296 of 3mp3B
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
36% identity, 89% coverage: 4:291/325 of query aligns to 2:283/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
35% identity, 89% coverage: 4:291/325 of query aligns to 2:283/296 of 3mp5B
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
34% identity, 90% coverage: 1:291/325 of query aligns to 71:355/370 of Q8TB92
Sites not aligning to the query:
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
40% identity, 85% coverage: 6:280/325 of query aligns to 2:270/283 of 1ydnA
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
38% identity, 83% coverage: 8:278/325 of query aligns to 4:268/301 of P13703
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
29% identity, 89% coverage: 7:296/325 of query aligns to 3:280/308 of 3rmjB
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
29% identity, 89% coverage: 7:296/325 of query aligns to 6:283/517 of Q9JZG1
Sites not aligning to the query:
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
36% identity, 25% coverage: 165:245/325 of query aligns to 176:255/418 of Q9Y823
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
36% identity, 25% coverage: 165:245/325 of query aligns to 171:250/400 of 3ivtB
Sites not aligning to the query:
3ivsA Homocitrate synthase lys4 (see paper)
36% identity, 25% coverage: 165:245/325 of query aligns to 140:219/364 of 3ivsA
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
36% identity, 25% coverage: 165:245/325 of query aligns to 142:221/370 of 3mi3A
Sites not aligning to the query:
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 63% coverage: 85:289/325 of query aligns to 177:367/506 of Q9FG67
Sites not aligning to the query:
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
33% identity, 34% coverage: 169:280/325 of query aligns to 162:266/453 of 2nx9B
Sites not aligning to the query:
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 66% coverage: 85:298/325 of query aligns to 177:381/503 of Q9FN52
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
25% identity, 62% coverage: 98:298/325 of query aligns to 117:314/409 of 6e1jA
Sites not aligning to the query:
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
28% identity, 82% coverage: 15:282/325 of query aligns to 11:266/376 of O87198
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
27% identity, 82% coverage: 15:282/325 of query aligns to 11:260/314 of 2zyfA
>BPHYT_RS03930 FitnessBrowser__BFirm:BPHYT_RS03930
MSDIQERVVVTEVGMRDGLQSIARTMPTEFKRRWIDAAYAAGVRHMEVASFVPAKLLPQM
ADADEVIAHALTYDDLMVTALVPNLKGAQRALEAGVHRIVAPISVSSAHSLANVRRTPAE
MIEAFAAMRESIDGTSKAGGRRVELIAGLSTVFGCTLQGAVPYADIAAIARAAVQAGADV
IALGDTTGEATPRQVGEIIELVRDVVGGKLHSLHFHDTRGLGLANTLVALQHGIREFDAS
LAGLGGCPHAPGATGNVNTEDLVFMLDSMGYETGIDLDRLLASRAVLADALPGEPLYGYL
ARAGLPKQFSATRQRFESSDSQVLQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory