SitesBLAST
Comparing BPHYT_RS04375 FitnessBrowser__BFirm:BPHYT_RS04375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
23% identity, 99% coverage: 3:316/318 of query aligns to 2:311/313 of 6bwlA
- active site: T122 (≠ S117), C123 (≠ I118), M124 (≠ K119), Y147 (= Y142), K151 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), N35 (= N26), S36 (≠ T27), D57 (≠ S49), I58 (≠ V50), L79 (= L71), A80 (= A72), A81 (= A73), I83 (≠ V75), M120 (≠ V115), K151 (= K146), N176 (≠ L171), T177 (≠ V172)
- binding uridine-5'-diphosphate: N176 (≠ L171), G189 (vs. gap), V190 (vs. gap), N205 (≠ P195), I206 (≠ L196), Y207 (≠ G197), Q212 (≠ R202), R214 (= R203), I250 (= I239), E275 (≠ W263)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 98% coverage: 3:314/318 of query aligns to 10:321/667 of Q9LPG6
- G18 (= G11) mutation to A: Abolishes dehydratase activity.
- K36 (≠ V28) mutation to A: Reduces dehydratase activity.
- D96 (≠ E80) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K146) mutation to A: Abolishes dehydratase activity.
- G193 (= G174) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
31% identity, 80% coverage: 3:256/318 of query aligns to 3:265/308 of 6wj9B
- active site: A119 (≠ S117), A120 (≠ I118), A121 (≠ K119), F144 (≠ Y142), K148 (= K146)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (≠ V13), D32 (vs. gap), D33 (vs. gap), S35 (vs. gap), T36 (= T29), G37 (= G30), D55 (≠ P48), A56 (≠ S49), L75 (= L71), A76 (= A72), A77 (= A73), S94 (≠ T92), A117 (≠ V115), A119 (≠ S117), F144 (≠ Y142), K148 (= K146), F171 (≠ P169), F172 (≠ P170), I174 (≠ V172)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V77), N173 (≠ L171), G187 (≠ N180), V188 (≠ F181), F192 (≠ M185), T203 (≠ P195), L204 (= L196), F205 (vs. gap), R212 (= R203), L248 (≠ I239)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
31% identity, 80% coverage: 3:256/318 of query aligns to 2:264/307 of 6wjaA
- active site: A118 (≠ S117), A119 (≠ I118), A120 (≠ K119), F143 (≠ Y142), K147 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (vs. gap), D32 (vs. gap), S34 (vs. gap), T35 (= T29), G36 (= G30), A55 (≠ S49), L74 (= L71), A75 (= A72), A76 (= A73), S93 (≠ T92), F143 (≠ Y142), K147 (= K146), F170 (≠ P169), F171 (≠ P170), I173 (≠ V172)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V77), A120 (≠ K119), N172 (≠ L171), G186 (≠ N180), V187 (≠ F181), F191 (≠ M185), T202 (≠ P195), F204 (vs. gap), R211 (= R203), L247 (≠ I239)
Sites not aligning to the query:
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
27% identity, 98% coverage: 4:315/318 of query aligns to 3:296/299 of 6kv9A
- active site: S110 (= S117), S111 (≠ I118), S112 (≠ K119), Y133 (= Y142), K137 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), R32 (= R33), R33 (= R34), D47 (= D51), L48 (≠ F52), L66 (≠ V77), A67 (≠ M78), A68 (≠ L79), P70 (≠ D81), C85 (≠ T92), A108 (≠ V115), S109 (= S116), K137 (= K146), F162 (≠ P169), T164 (≠ L171), V165 (= V172), R171 (= R178), M174 (vs. gap)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ D81), R73 (≠ D84), S110 (= S117), S111 (≠ I118), Y133 (= Y142), T164 (≠ L171), R171 (= R178), M174 (vs. gap), F175 (= F181), R178 (vs. gap), E190 (≠ P195), I191 (≠ L196), Y192 (≠ G197), Q197 (≠ R202), R199 (= R203), V235 (≠ I239), D261 (≠ S283)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
25% identity, 99% coverage: 3:317/318 of query aligns to 2:307/309 of 4zrnA
- active site: T117 (≠ S117), G119 (≠ K119), A120 (= A120), Y143 (= Y142), K147 (= K146), Y181 (vs. gap), G185 (≠ D176)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), S34 (≠ Q35), S35 (≠ M36), G36 (≠ P37), S51 (= S49), I52 (≠ V50), L73 (= L71), A74 (= A72), A75 (= A73), T92 (= T92), S115 (≠ V115), S116 (= S116), Y143 (= Y142), K147 (= K146), Y170 (≠ P169), V173 (= V172)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S117), G119 (≠ K119), A120 (= A120), Y143 (= Y142), N172 (≠ L171), G185 (≠ D176), V186 (= V177), H201 (≠ P195), F203 (≠ G197), Y208 (≠ R202), R210 (= R203), V244 (≠ I239), R267 (= R273), D270 (≠ Q276)
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
27% identity, 98% coverage: 4:315/318 of query aligns to 3:295/299 of 6kvcA
- active site: S109 (= S117), S110 (≠ I118), S111 (≠ K119), Y132 (= Y142), K136 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), R32 (= R33), R33 (= R34), D46 (= D51), L47 (≠ F52), L65 (≠ V77), A66 (≠ M78), A67 (≠ L79), P69 (≠ D81), A107 (≠ V115), S109 (= S117), K136 (= K146), F161 (≠ P169), T163 (≠ L171), V164 (= V172), R170 (= R178), M173 (vs. gap)
- binding uridine-5'-diphosphate-glucose: P69 (≠ D81), R72 (≠ D84), S109 (= S117), S110 (≠ I118), Y132 (= Y142), T163 (≠ L171), M173 (vs. gap), F174 (= F181), R177 (vs. gap), E189 (≠ P195), I190 (≠ L196), Y191 (≠ G197), Q196 (≠ R202), R198 (= R203), D260 (≠ S283)
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
41% identity, 52% coverage: 4:168/318 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S117), Y132 (= Y142), K136 (= K146)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), R10 (≠ F12), V11 (= V13), D30 (≠ V32), L31 (≠ R33), R32 (= R34), S44 (≠ P48), L45 (≠ S49), L64 (= L71), A66 (= A73), V81 (≠ T92), S106 (= S117), Y132 (= Y142), K136 (= K146)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
41% identity, 52% coverage: 4:168/318 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S117), Y133 (= Y142), K137 (= K146)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), R11 (≠ F12), V12 (= V13), D31 (≠ V32), L32 (≠ R33), S45 (≠ P48), L46 (≠ S49), L65 (= L71), A67 (= A73), V82 (≠ T92), Y133 (= Y142), K137 (= K146)
Sites not aligning to the query:
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
24% identity, 99% coverage: 2:316/318 of query aligns to 2:306/312 of 2b69A
- active site: T115 (≠ I118), S116 (≠ K119), E117 (≠ A120), Y144 (= Y142), K148 (= K146), R185 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), V13 (= V13), D32 (≠ V32), N33 (≠ R33), T36 (≠ M36), G37 (≠ P37), D57 (= D56), V58 (≠ A57), L72 (= L71), A73 (= A72), S74 (≠ A73), A76 (= A82), T91 (= T92), T115 (≠ I118), Y144 (= Y142), K148 (= K146), I171 (≠ P169), N173 (≠ L171), R185 (vs. gap)
- binding uridine-5'-diphosphate: P61 (= P60), L62 (≠ E61), Y63 (≠ A62), P78 (≠ D84), N98 (≠ R99), G101 (≠ R102), L102 (≠ A103), K104 (≠ W105), R105 (= R106), Y158 (≠ L156), N173 (≠ L171), R185 (vs. gap), V186 (vs. gap), N189 (≠ S183), T201 (≠ P195), Y203 (≠ G197), Q208 (≠ R202), R210 (= R203), I244 (= I239), D270 (= D278)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
24% identity, 99% coverage: 2:316/318 of query aligns to 89:393/420 of Q8NBZ7
- G98 (= G11) binding
- F99 (= F12) binding
- V100 (= V13) binding
- D119 (≠ V32) binding
- N120 (≠ R33) binding
- F122 (≠ Q35) binding
- T123 (≠ M36) binding
- G124 (≠ P37) binding
- D144 (= D56) binding
- V145 (≠ A57) binding
- L149 (≠ E61) binding
- Y150 (≠ A62) binding
- L159 (= L71) binding
- S161 (≠ A73) binding
- K177 (≠ A91) binding
- T178 (= T92) binding
- N185 (≠ R99) binding
- G188 (≠ R102) binding
- K191 (≠ W105) binding
- R192 (= R106) binding
- A200 (≠ S116) binding
- E204 (≠ A120) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y142) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K146) binding
- R236 (= R147) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (≠ L156) binding
- Q248 (= Q159) binding
- E249 (≠ T160) binding
- T261 (≠ V172) binding
- H267 (≠ R178) binding
- R272 (vs. gap) binding
- R361 (≠ L284) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
25% identity, 99% coverage: 1:314/318 of query aligns to 3:337/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G13 (= G11), F14 (= F12), I15 (≠ V13), D36 (≠ R34), A37 (≠ Q35), L38 (≠ M36), T39 (≠ P37), G42 (≠ Y40), D62 (= D56), I63 (≠ A57), L84 (= L71), A85 (= A72), A86 (= A73), T103 (= T92), S143 (= S116), T144 (≠ S117), Y169 (= Y142), K173 (= K146), C196 (≠ P169)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 99% coverage: 1:314/318 of query aligns to 1:331/355 of P27830
- FI 12:13 (≠ FV 12:13) binding
- DKLT 33:36 (≠ ---T 27) binding
- D-I 59:60 (≠ DPS 47:49) binding
- T100 (= T92) binding
- D135 (≠ I118) active site, Proton donor
- E136 (≠ K119) active site, Proton acceptor
- Y160 (= Y142) active site, Proton acceptor
- YSASK 160:164 (≠ YGRSK 142:146) binding
- N190 (≠ V172) binding
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
28% identity, 99% coverage: 3:317/318 of query aligns to 2:314/322 of 1r6dA
- active site: T127 (≠ S117), N128 (≠ I118), Q129 (≠ K119), Y151 (= Y142), K155 (= K146)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ V75), H88 (= H76), T127 (≠ S117), N128 (≠ I118), Q129 (≠ K119), Y151 (= Y142), N180 (≠ L171), K190 (≠ F181), L191 (= L182), P206 (= P195), Y208 (≠ G197), R215 (= R203), N250 (≠ I239), R274 (= R273), H277 (≠ Q276), Y281 (≠ L284)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (≠ V13), D37 (vs. gap), S38 (≠ A20), L39 (= L21), T40 (≠ R22), A42 (= A24), G43 (= G25), D63 (≠ S49), I64 (≠ V50), F83 (≠ L71), A84 (= A72), A85 (= A73), S87 (≠ V75), T102 (= T92), V125 (= V115), S126 (= S116), Y151 (= Y142), K155 (= K146), N181 (≠ V172)
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
24% identity, 79% coverage: 65:314/318 of query aligns to 81:319/669 of Q9SYM5
- R283 (= R273) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
34% identity, 54% coverage: 3:175/318 of query aligns to 2:179/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), T35 (≠ M36), G36 (≠ P37), D56 (= D51), I57 (≠ F52), L77 (= L71), A78 (= A72), A79 (= A73), I81 (≠ V75), V96 (≠ T92), T119 (≠ V115), Y146 (= Y142), K150 (= K146), P173 (= P169), A174 (≠ P170), N175 (≠ L171), V176 (= V172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V75), R84 (≠ M78), S121 (= S117), G123 (≠ K119), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
28% identity, 99% coverage: 3:317/318 of query aligns to 2:314/322 of 1r66A
- active site: T127 (≠ S117), D128 (≠ I118), E129 (≠ K119), Y151 (= Y142), K155 (= K146)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (≠ V13), D37 (vs. gap), S38 (≠ A20), L39 (= L21), T40 (≠ R22), G43 (= G25), D63 (≠ S49), I64 (≠ V50), F83 (≠ L71), A84 (= A72), A85 (= A73), S87 (≠ V75), T102 (= T92), V125 (= V115), S126 (= S116), Y151 (= Y142), K155 (= K146), N181 (≠ V172)
- binding thymidine-5'-diphosphate: H88 (= H76), E129 (≠ K119), N180 (≠ L171), K190 (≠ F181), L191 (= L182), P206 (= P195), Y208 (≠ G197), R215 (= R203), N250 (≠ I239), R274 (= R273), H277 (≠ Q276)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
34% identity, 54% coverage: 3:175/318 of query aligns to 2:179/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), T35 (≠ M36), G36 (≠ P37), D56 (= D51), I57 (≠ F52), L77 (= L71), A78 (= A72), A79 (= A73), I81 (≠ V75), T119 (≠ V115), Y146 (= Y142), K150 (= K146), P173 (= P169), N175 (≠ L171), V176 (= V172)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ V75), R84 (≠ M78), S121 (= S117), G123 (≠ K119), S124 (≠ A120), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
34% identity, 54% coverage: 3:175/318 of query aligns to 2:179/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ V75), R84 (≠ M78), S121 (= S117), G123 (≠ K119), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), A34 (≠ Q35), T35 (≠ M36), G36 (≠ P37), D56 (= D51), I57 (≠ F52), L77 (= L71), A78 (= A72), A79 (= A73), I81 (≠ V75), T119 (≠ V115), Y146 (= Y142), K150 (= K146), P173 (= P169), A174 (≠ P170), V176 (= V172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V75), R84 (≠ M78), S121 (= S117), G123 (≠ K119), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
- binding galactose-uridine-5'-diphosphate: 187, 188, 189, 193, 204, 206, 211, 213, 248, 271
- binding uridine-5'-diphosphate-glucose: 187, 188, 189, 193, 204, 206, 211, 213, 248, 271
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
29% identity, 99% coverage: 1:314/318 of query aligns to 1:325/344 of 1bxkB
- active site: S125 (≠ G108), T134 (≠ S117), D135 (≠ I118), E136 (≠ K119), S158 (≠ D140), Y160 (= Y142), S161 (≠ G143), K164 (= K146)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (≠ V13), D33 (vs. gap), K34 (vs. gap), L35 (vs. gap), T36 (= T27), A38 (≠ T29), G39 (= G30), D59 (= D47), I60 (≠ S49), L81 (= L71), A83 (= A73), T100 (= T92), I132 (≠ V115), S133 (= S116), T134 (≠ S117), K164 (= K146), C187 (≠ P169)
Query Sequence
>BPHYT_RS04375 FitnessBrowser__BFirm:BPHYT_RS04375
MSRVLVTGANGFVGRALCRALRDAGNTVTGLVRRQMPREYGVDEWVDPSVDFAGMDAGWP
EALQVDCVVHLAARVHVMLEDAADPEAAFQATNVEGTLRCARAAWRHGVRRFVFVSSIKA
MTEADSGRPVREDDSPAPQDPYGRSKRAAEEALIRLGAQTGLEIVIVRPPLVYGPDVRAN
FLSLMNAVWKGVPLPLGALGARRSLVYVDNLADALVHCATDARAAQQCFHVADSDALTIA
ELARALGRHLGRPARLLPVPESWLRLAGRLTGRTAQVDRLVGSLQLDTSRIRTVLGWQAP
YSTEEGLAATAHWYRSTH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory