SitesBLAST
Comparing BPHYT_RS04775 FitnessBrowser__BFirm:BPHYT_RS04775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
33% identity, 94% coverage: 15:260/263 of query aligns to 10:242/245 of 5t5qC
- active site: G18 (= G23), S140 (= S146), N150 (≠ R156), Y153 (= Y159), K157 (= K163)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ A21), G17 (≠ A22), G18 (= G23), I19 (= I24), D38 (= D43), L39 (≠ V44), D63 (= D65), A64 (≠ V66), S90 (≠ N92), I113 (≠ T116), Y153 (= Y159), K157 (= K163), P182 (= P189), I185 (≠ V192), T187 (≠ G194), M189 (≠ R196)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
35% identity, 95% coverage: 12:260/263 of query aligns to 7:255/258 of 3ak4A
- active site: G18 (= G23), S141 (= S146), L151 (≠ R156), Y154 (= Y159), K158 (= K163), E199 (≠ R204)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ A22), G18 (= G23), I19 (= I24), D38 (= D43), L39 (≠ V44), V60 (≠ A64), D61 (= D65), V62 (= V66), N88 (= N92), A89 (= A93), G90 (= G94), T139 (≠ M144), S141 (= S146), Y154 (= Y159), K158 (= K163), G185 (= G190), V187 (= V192), T189 (≠ G194), M191 (≠ R196)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
34% identity, 94% coverage: 12:258/263 of query aligns to 4:250/255 of 2q2qD
- active site: G15 (= G23), S138 (= S146), Y151 (= Y159), K155 (= K163), R196 (= R204)
- binding nicotinamide-adenine-dinucleotide: G11 (= G19), T13 (≠ A21), S14 (≠ A22), G15 (= G23), I16 (= I24), F36 (vs. gap), D59 (= D65), L60 (≠ V66), N86 (= N92), G88 (= G94), L109 (≠ T116), I136 (≠ M144), S138 (= S146), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), W183 (≠ V191), V184 (= V192), T186 (≠ G194), L188 (≠ R196), V189 (≠ M197)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
35% identity, 96% coverage: 7:258/263 of query aligns to 1:252/257 of 6pejA
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
30% identity, 94% coverage: 12:258/263 of query aligns to 5:243/248 of 4urfB
- active site: G16 (= G23), S142 (= S146), I152 (≠ R156), Y155 (= Y159), K159 (= K163)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L225), R211 (= R226), R212 (= R227)
- binding bicarbonate ion: I92 (= I95), G94 (= G97), R109 (= R112), R179 (= R183), S228 (= S243)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), G14 (≠ A21), N15 (≠ A22), G16 (= G23), I17 (= I24), D36 (= D43), I37 (≠ V44), D62 (≠ R53), T63 (= T54), N89 (= N92), A90 (= A93), G91 (= G94), I140 (≠ M144), Y155 (= Y159), K159 (= K163), P185 (= P189), A186 (≠ G190), I188 (≠ V192), T190 (≠ G194)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
30% identity, 94% coverage: 12:258/263 of query aligns to 5:243/248 of 4urfA
- active site: G16 (= G23), S142 (= S146), I152 (≠ R156), Y155 (= Y159), K159 (= K163)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I95), S93 (≠ A96), G94 (= G97), E95 (≠ P98), T97 (≠ G100), E101 (≠ D104), T103 (≠ D106), Q106 (≠ E109), R109 (= R112), S175 (≠ P179), G177 (≠ N181)
- binding magnesium ion: S237 (≠ Q252), Y238 (≠ A253)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), G14 (≠ A21), N15 (≠ A22), G16 (= G23), I17 (= I24), D36 (= D43), I37 (≠ V44), W41 (vs. gap), D62 (≠ R53), T63 (= T54), N89 (= N92), A90 (= A93), G91 (= G94), I140 (≠ M144), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (≠ V192), T190 (≠ G194)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
30% identity, 94% coverage: 12:258/263 of query aligns to 5:243/248 of 4ureB
- active site: G16 (= G23), S142 (= S146), I152 (≠ R156), Y155 (= Y159), K159 (= K163)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ A22), G16 (= G23), I17 (= I24), N89 (= N92), G91 (= G94), Y155 (= Y159), P185 (= P189), A186 (≠ G190)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
32% identity, 93% coverage: 16:260/263 of query aligns to 11:242/244 of 4nbuB
- active site: G18 (= G23), N111 (= N117), S139 (= S146), Q149 (≠ R156), Y152 (= Y159), K156 (= K163)
- binding acetoacetyl-coenzyme a: D93 (≠ P98), K98 (≠ D104), S139 (= S146), N146 (≠ Y153), V147 (≠ A154), Q149 (≠ R156), Y152 (= Y159), F184 (≠ V191), M189 (vs. gap), K200 (≠ Q214)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), N17 (≠ A22), G18 (= G23), I19 (= I24), D38 (= D43), F39 (≠ V44), V59 (≠ A64), D60 (= D65), V61 (= V66), N87 (= N92), A88 (= A93), G89 (= G94), I90 (= I95), T137 (≠ M144), S139 (= S146), Y152 (= Y159), K156 (= K163), P182 (= P189), F184 (≠ V191), T185 (≠ V192), T187 (vs. gap), M189 (vs. gap)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 93% coverage: 15:258/263 of query aligns to 10:250/255 of 5itvA
- active site: G18 (= G23), S141 (= S146), Y154 (= Y159), K158 (= K163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), S17 (≠ A22), G18 (= G23), I19 (= I24), D38 (= D43), I39 (≠ V44), T61 (≠ A64), I63 (≠ V66), N89 (= N92), G91 (= G94), T139 (≠ M144), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I186 (≠ V191), I187 (≠ V192)
3sjuA Hedamycin polyketide ketoreductase bound to NADPH (see paper)
32% identity, 93% coverage: 16:260/263 of query aligns to 4:252/255 of 3sjuA
- active site: G11 (= G23), S138 (= S146), Y151 (= Y159), K155 (= K163), Y196 (≠ R204)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G19), S10 (≠ A22), A31 (≠ D43), R32 (≠ V44), D33 (= D45), C56 (≠ A64), D57 (= D65), V58 (= V66), S84 (≠ N92), A85 (= A93), G86 (= G94), I136 (≠ M144), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), Y183 (≠ V191), V184 (= V192), T186 (≠ G194), M188 (≠ R196)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
32% identity, 94% coverage: 12:258/263 of query aligns to 9:247/259 of 6ci9D
- active site: G20 (= G23), S145 (= S146), Y159 (= Y159)
- binding 1-aminopropan-2-one: F97 (≠ A96), S145 (= S146), T147 (≠ A148), W156 (≠ R156), Y159 (= Y159), G190 (= G190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G19), S18 (≠ A21), G20 (= G23), I21 (= I24), G40 (vs. gap), R41 (vs. gap), N42 (vs. gap), D66 (= D65), V67 (= V66), N93 (= N92), G95 (= G94), T143 (≠ M144), S145 (= S146), Y159 (= Y159), K163 (= K163), P189 (= P189), N191 (≠ V191), I192 (≠ V192), T194 (≠ G194), G196 (= G211), L197 (≠ F212)
4b79A The aeropath project and pseudomonas aeruginosa high-throughput crystallographic studies for assessment of potential targets in early stage drug discovery. (see paper)
33% identity, 94% coverage: 12:258/263 of query aligns to 10:231/236 of 4b79A
- active site: G21 (= G23), S133 (= S146), R143 (= R156), Y146 (= Y159), K150 (= K163)
- binding nicotinamide-adenine-dinucleotide: G17 (= G19), S19 (≠ A21), S20 (≠ A22), G21 (= G23), I22 (= I24), L42 (≠ V44), L60 (≠ A64), D61 (= D65), I62 (≠ V66), N84 (= N92), G86 (= G94), L105 (≠ T116), I131 (≠ M144), Y146 (= Y159), K150 (= K163), P176 (= P189), G177 (= G190), I179 (≠ V192), T181 (≠ G194)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
32% identity, 94% coverage: 16:262/263 of query aligns to 6:255/256 of Q48436
- 6:33 (vs. 16:43, 46% identical) binding
- D59 (= D65) binding
- K156 (= K163) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
33% identity, 94% coverage: 16:262/263 of query aligns to 6:255/256 of 1gegE
- active site: G13 (= G23), S139 (= S146), Y152 (= Y159), K156 (= K163), V197 (≠ I201)
- binding alpha-D-glucopyranose: R63 (≠ C69), D64 (≠ A70), F67 (≠ D73), E123 (≠ P130)
- binding nicotinamide-adenine-dinucleotide: G9 (= G19), Q12 (≠ A22), I14 (= I24), D33 (= D43), Y34 (≠ V44), V58 (vs. gap), D59 (= D65), V60 (= V66), N86 (= N92), A87 (= A93), I109 (≠ T116), S139 (= S146), Y152 (= Y159), K156 (= K163), P182 (= P189), V185 (= V192), T187 (≠ G194), M189 (vs. gap)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
33% identity, 92% coverage: 16:258/263 of query aligns to 8:255/260 of 2ztlA
- active site: G15 (= G23), N114 (= N117), S142 (= S146), Y155 (= Y159), K159 (= K163), L200 (≠ R204)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ A96), S142 (= S146), H144 (≠ A148), K152 (≠ R156), Y155 (= Y159), Q196 (≠ V200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G19), G15 (= G23), I16 (= I24), F36 (≠ V44), L64 (≠ V66), N90 (= N92), A91 (= A93), G92 (= G94), L113 (≠ T116), Y155 (= Y159), K159 (= K163), P185 (= P189), W187 (≠ V191), V188 (= V192), T190 (≠ G194), V193 (≠ M197)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
33% identity, 92% coverage: 16:258/263 of query aligns to 8:255/260 of 1wmbA
Sites not aligning to the query:
5ha5D Crystal structure of an NAD-bound oxidoreductase from brucella ovis
34% identity, 93% coverage: 15:258/263 of query aligns to 9:239/244 of 5ha5D
- active site: G17 (= G23), S142 (= S146), Y155 (= Y159), K159 (= K163)
- binding nicotinamide-adenine-dinucleotide: G13 (= G19), R16 (≠ A22), G17 (= G23), L18 (≠ I24), D37 (= D43), I38 (≠ V44), L62 (vs. gap), D63 (= D65), V64 (= V66), N90 (= N92), A91 (= A93), S142 (= S146), Y155 (= Y159), K159 (= K163), G186 (= G190), M188 (≠ V192), S190 (≠ A205)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
33% identity, 94% coverage: 15:260/263 of query aligns to 8:236/240 of 2d1yA
- active site: G16 (= G23), S135 (= S146), N145 (≠ R156), Y148 (= Y159), K152 (= K163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), R15 (≠ A22), I17 (= I24), D36 (= D43), L37 (≠ V44), R38 (≠ D45), V55 (≠ A64), D56 (= D65), L57 (≠ V66), N83 (= N92), A84 (= A93), A85 (≠ G94), I86 (= I95), V133 (≠ M144), S135 (= S146), Y148 (= Y159), K152 (= K163), P178 (= P189), G179 (= G190), I181 (≠ V192), T183 (≠ G194), A185 (≠ R196), V186 (≠ M197)
5ts3A Crystal structure of a 3-oxoacyl-[acyl-carrier protein] reductase with bound NAD from brucella melitensis
36% identity, 96% coverage: 7:258/263 of query aligns to 13:260/265 of 5ts3A
- active site: G30 (= G23), S158 (= S146), V168 (≠ F155), Y172 (= Y159), K176 (= K163)
- binding nicotinamide-adenine-dinucleotide: G26 (= G19), R29 (≠ A22), G30 (= G23), I31 (= I24), D50 (= D43), L51 (≠ V44), D77 (= D65), V78 (= V66), N101 (= N92), V129 (≠ T116), T156 (≠ M144), Y172 (= Y159), K176 (= K163), P202 (= P189), I205 (≠ V200), T207 (≠ S202)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
32% identity, 98% coverage: 1:258/263 of query aligns to 2:246/251 of 6d9yB
- active site: G20 (= G23), S145 (= S146), Y158 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G16 (= G19), R19 (≠ A22), G20 (= G23), D40 (= D43), L41 (≠ V44), V64 (≠ A64), D65 (= D65), Q66 (≠ V66), A93 (= A93), S145 (= S146), Y158 (= Y159), K162 (= K163), P188 (= P189), A189 (≠ G190), A190 (≠ V191), A191 (≠ V192), T193 (≠ G194)
Query Sequence
>BPHYT_RS04775 FitnessBrowser__BFirm:BPHYT_RS04775
MKTIDLLRPTPGLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLH
AGVADVSDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNS
QFYFLRKAVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPN
NVRVNAILPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALF
LASPAGQNISGQAISVDGNVEYL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory