Comparing BPHYT_RS05025 BPHYT_RS05025 sugar ABC transporter substrate-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
52% identity, 94% coverage: 22:413/415 of query aligns to 1:392/395 of 4r2bA
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
55% identity, 93% coverage: 27:413/415 of query aligns to 4:393/396 of 5dvjA
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
55% identity, 93% coverage: 27:413/415 of query aligns to 4:393/396 of 5dviA
8hqqA Crystal structure of the glucose-binding protein sar11_0769 from "candidatus pelagibacter ubique" htcc1062 bound to glucose
52% identity, 91% coverage: 25:401/415 of query aligns to 2:383/398 of 8hqqA
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
27% identity, 90% coverage: 28:399/415 of query aligns to 3:372/392 of 2b3fA
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
27% identity, 90% coverage: 28:399/415 of query aligns to 3:372/392 of 2b3bC
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
27% identity, 90% coverage: 28:399/415 of query aligns to 3:372/392 of 2b3bA
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
29% identity, 49% coverage: 91:293/415 of query aligns to 66:266/390 of 3oo6A
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
28% identity, 49% coverage: 69:270/415 of query aligns to 43:247/392 of 4g68A
Sites not aligning to the query:
3vxcA Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
28% identity, 36% coverage: 128:276/415 of query aligns to 107:264/398 of 3vxcA
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
25% identity, 50% coverage: 74:282/415 of query aligns to 55:268/406 of 7ehqA
Sites not aligning to the query:
6preA Sbp rafe in complex with verbascose (see paper)
27% identity, 27% coverage: 74:184/415 of query aligns to 47:156/386 of 6preA
Sites not aligning to the query:
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
27% identity, 27% coverage: 74:184/415 of query aligns to 46:155/385 of 2i58A
Sites not aligning to the query:
>BPHYT_RS05025 BPHYT_RS05025 sugar ABC transporter substrate-binding protein
MKFRAIMGALCAAGLMCGVSAVQAAESIEVLHWWTSGGESKAVGVLKDDMTKQGYTWKDF
AVAGGAGAAAMTALKTQVISGNAPSAAQIKGPLIQDWASQGVLVPIDAAAGDWKKNLPPE
IDKIMHADGHYVAAPFSVHRVNWLYINKAALDKAGGKAPTTWPEFFAVADKMKAAGIQPI
AMGGQPWQDLTLWEDVVLSQGADFYKKALVDLDEKTLTSDKMVGVFDTVRKIQGYFDAGR
TGRDWNLATAMVINGKAGMQFMGDWAKGEFANAGKKSGSDYICAAVPGTEKSYTFNVDSF
VFFQQKGQKAATPGQLALAKTIMSPEFQEQFSLNKGSIPVRLGVSMAKFDDCAKKSYADE
QVAIKSGGYVPSLAHGMAQPDAAAGAISDVVTKFMNSQQDSKSAVAALAKAAKTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory