SitesBLAST
Comparing BPHYT_RS05070 FitnessBrowser__BFirm:BPHYT_RS05070 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
68% identity, 95% coverage: 4:319/333 of query aligns to 4:319/319 of 5vt3B
- active site: C138 (= C138), C141 (= C141), D142 (= D142)
- binding flavin-adenine dinucleotide: G15 (= G15), S16 (= S16), G17 (= G17), P18 (= P18), A19 (= A19), T38 (= T38), G39 (= G39), Q41 (≠ A41), G44 (= G44), Q45 (= Q45), L46 (= L46), T49 (= T49), N54 (= N54), H86 (= H86), I87 (= I87), S114 (= S114), T115 (= T115), G116 (= G116), E162 (= E162), H247 (= H247), G287 (= G287), D288 (= D288), R295 (= R295), Q296 (= Q296), A297 (= A297), S300 (= S300)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L122), G156 (= G156), G157 (= G157), N158 (= N158), T159 (= T159), H178 (= H178), R179 (= R179), R180 (= R180), R184 (= R184), I245 (= I245), G246 (= G246), R295 (= R295), Q296 (= Q296)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
69% identity, 94% coverage: 5:316/333 of query aligns to 3:315/321 of P0A9P4
- 36:43 (vs. 38:45, 63% identical) binding
- C136 (= C138) modified: Disulfide link with 139, Redox-active
- C139 (= C141) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 288:297, 80% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
69% identity, 94% coverage: 4:316/333 of query aligns to 5:317/319 of 5u63B
- active site: C139 (= C138), C142 (= C141), D143 (= D142)
- binding flavin-adenine dinucleotide: G16 (= G15), S17 (= S16), G18 (= G17), P19 (= P18), A20 (= A19), T39 (= T38), G40 (= G39), Q42 (≠ A41), G45 (= G44), Q46 (= Q45), L47 (= L46), T50 (= T49), N55 (= N54), H87 (= H86), I88 (= I87), A115 (≠ S114), T116 (= T115), G117 (= G116), H248 (= H247), G288 (= G287), D289 (= D288), R296 (= R295), Q297 (= Q296), A298 (= A297), S301 (= S300)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (≠ Q120), G157 (= G156), H179 (= H178), R180 (= R179), R181 (= R180), I246 (= I245), G247 (= G246), H248 (= H247), R296 (= R295)
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
69% identity, 94% coverage: 5:316/333 of query aligns to 2:314/320 of 1f6mA
- active site: S135 (≠ C138), C138 (= C141), D139 (= D142)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L122), G153 (= G156), G154 (= G157), N155 (= N158), T156 (= T159), E159 (= E162), H175 (= H178), R176 (= R179), R177 (= R180), R181 (= R184), I243 (= I245), G244 (= G246), H245 (= H247), R293 (= R295), Q294 (= Q296)
- binding flavin-adenine dinucleotide: G12 (= G15), S13 (= S16), G14 (= G17), P15 (= P18), A16 (= A19), T35 (= T38), G36 (= G39), E38 (≠ A41), G41 (= G44), Q42 (= Q45), L43 (= L46), T46 (= T49), V49 (= V52), N51 (= N54), H83 (= H86), I84 (= I87), A111 (≠ S114), T112 (= T115), G113 (= G116), H245 (= H247), G285 (= G287), D286 (= D288), R293 (= R295), Q294 (= Q296), A295 (= A297), S298 (= S300)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
69% identity, 94% coverage: 5:316/333 of query aligns to 2:314/316 of 1tdfA
- active site: C135 (= C138), S138 (≠ C141), D139 (= D142)
- binding flavin-adenine dinucleotide: G12 (= G15), S13 (= S16), G14 (= G17), P15 (= P18), A16 (= A19), T35 (= T38), G36 (= G39), E38 (≠ A41), G41 (= G44), Q42 (= Q45), L43 (= L46), T46 (= T49), V49 (= V52), N51 (= N54), H83 (= H86), I84 (= I87), A111 (≠ S114), T112 (= T115), S138 (≠ C141), G285 (= G287), D286 (= D288), R293 (= R295), Q294 (= Q296), A295 (= A297), S298 (= S300)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L122), I151 (= I154), T156 (= T159), E159 (= E162), H175 (= H178), R176 (= R179), R181 (= R184), E183 (= E186), I243 (= I245), G244 (= G246), H290 (= H292), R293 (= R295)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
56% identity, 93% coverage: 5:315/333 of query aligns to 3:311/315 of 4jnqA
- active site: C137 (= C138), C140 (= C141), D141 (= D142)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L14), G13 (= G15), S14 (= S16), G15 (= G17), P16 (= P18), A17 (= A19), A36 (≠ T38), G37 (= G39), Q39 (≠ A41), G42 (= G44), Q43 (= Q45), L44 (= L46), N52 (= N54), I85 (= I87), A113 (≠ S114), T114 (= T115), C140 (= C141), G283 (= G287), D284 (= D288), R291 (= R295), Q292 (= Q296), A293 (= A297)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
46% identity, 97% coverage: 11:332/333 of query aligns to 17:325/335 of P9WHH1
- SGPA 22:25 (= SGPA 16:19) binding
- Y32 (= Y26) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 38:45, 38% identical) binding
- N60 (= N54) binding
- V93 (≠ I87) binding
- C145 (= C138) modified: Disulfide link with 148, Redox-active
- C148 (= C141) modified: Disulfide link with 145, Redox-active
- S166 (≠ T159) binding
- H185 (= H178) binding
- R191 (= R184) binding
- I248 (= I245) binding
- Y268 (= Y264) binding
- D288 (= D288) binding
- R295 (= R295) binding
- RQAV 295:298 (≠ RQAI 295:298) binding
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
47% identity, 92% coverage: 11:315/333 of query aligns to 5:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ L14), G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), E32 (≠ T38), G33 (= G39), Q35 (≠ A41), G38 (= G44), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (≠ H86), V81 (≠ I87), M109 (≠ T115), G110 (= G116), T131 (≠ A137), C135 (= C141), G274 (= G287), D275 (= D288), R282 (= R295), Q283 (= Q296), A284 (= A297), A287 (≠ S300)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ Q120), H115 (≠ Y121), L116 (= L122), R173 (= R179), E200 (≠ T209), I201 (≠ L210), I235 (= I245)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
47% identity, 92% coverage: 11:315/333 of query aligns to 5:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ L14), G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), E32 (≠ T38), G33 (= G39), Q35 (≠ A41), G38 (= G44), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (≠ H86), V81 (≠ I87), M109 (≠ T115), G110 (= G116), T131 (≠ A137), C135 (= C141), G274 (= G287), D275 (= D288), R282 (= R295), Q283 (= Q296), A284 (= A297), A287 (≠ S300)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L122), R173 (= R179), E200 (≠ T209), I201 (≠ L210)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
47% identity, 92% coverage: 11:315/333 of query aligns to 5:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), E32 (≠ T38), G33 (= G39), Q35 (≠ A41), G38 (= G44), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (≠ H86), V81 (≠ I87), M109 (≠ T115), G110 (= G116), T131 (≠ A137), C135 (= C141), G274 (= G287), D275 (= D288), R282 (= R295), Q283 (= Q296), A284 (= A297), A287 (≠ S300)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ Q120), H115 (≠ Y121), L116 (= L122), V148 (≠ I154), R173 (= R179), E200 (≠ T209), I201 (≠ L210)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
47% identity, 92% coverage: 11:315/333 of query aligns to 5:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ L14), G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), E32 (≠ T38), G33 (= G39), Q35 (≠ A41), G38 (= G44), A39 (≠ Q45), L40 (= L46), T43 (= T49), N48 (= N54), D80 (≠ H86), V81 (≠ I87), M109 (≠ T115), G110 (= G116), T131 (≠ A137), C135 (= C141), G274 (= G287), D275 (= D288), R282 (= R295), Q283 (= Q296), A284 (= A297), A287 (≠ S300)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G156), G151 (= G157), D152 (≠ N158), S153 (≠ T159), E156 (= E162), H172 (= H178), R173 (= R179), R174 (= R180), R178 (= R184), I235 (= I245)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
47% identity, 92% coverage: 11:315/333 of query aligns to 6:303/306 of 5uthA
- active site: C133 (= C138), C136 (= C141), D137 (= D142)
- binding flavin-adenine dinucleotide: I9 (≠ L14), G10 (= G15), S11 (= S16), G12 (= G17), P13 (= P18), A14 (= A19), F32 (≠ V37), E33 (≠ T38), G34 (= G39), Q36 (≠ A41), G39 (= G44), A40 (≠ Q45), L41 (= L46), N49 (= N54), D81 (≠ H86), V82 (≠ I87), M110 (≠ T115), G111 (= G116), C136 (= C141), G275 (= G287), D276 (= D288), R283 (= R295), Q284 (= Q296), A285 (= A297), A288 (≠ S300)
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
46% identity, 92% coverage: 11:315/333 of query aligns to 8:306/313 of 2a87A
- active site: F39 (≠ Q42), L43 (= L46), D48 (= D51), C136 (= C138), C139 (= C141), D140 (= D142)
- binding flavin-adenine dinucleotide: G12 (= G15), S13 (= S16), G14 (= G17), P15 (= P18), A16 (= A19), F34 (≠ V37), E35 (≠ T38), G36 (= G39), G40 (= G43), G41 (= G44), A42 (≠ Q45), L43 (= L46), T46 (= T49), V49 (= V52), N51 (= N54), D83 (≠ H86), V84 (≠ I87), M113 (≠ T115), C139 (= C141), G278 (= G287), D279 (= D288), R286 (= R295), Q287 (= Q296), A288 (= A297), V289 (≠ I298)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L122), G155 (= G157), D156 (≠ N158), S157 (≠ T159), H176 (= H178), R177 (= R179), R178 (= R180), R182 (= R184), I239 (= I245), Y259 (= Y264), R283 (≠ H292), R286 (= R295)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
47% identity, 97% coverage: 8:330/333 of query aligns to 17:343/356 of 5w4cA
- binding calcium ion: E99 (≠ D85), E116 (≠ D102), E118 (≠ G104)
- binding flavin-adenine dinucleotide: I23 (≠ L14), G24 (= G15), S25 (= S16), P27 (= P18), G28 (≠ A19), Y46 (vs. gap), G48 (vs. gap), A51 (≠ V37), F54 (≠ L40), G58 (= G44), Q59 (= Q45), L60 (= L46), T63 (= T49), N68 (= N54), V101 (≠ I87), T134 (= T115), G135 (= G116), G302 (= G287), D303 (= D288), R310 (= R295), Q311 (= Q296), A312 (= A297), S315 (= S300)
Sites not aligning to the query:
Q92375 Thioredoxin reductase; Caffeine resistance protein 4; EC 1.8.1.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
47% identity, 94% coverage: 8:320/333 of query aligns to 3:320/322 of Q92375
- S192 (≠ E186) modified: Phosphoserine
- T278 (= T278) modified: Phosphothreonine
- S279 (= S279) modified: Phosphoserine
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
47% identity, 94% coverage: 8:319/333 of query aligns to 3:319/319 of P29509
- SGPA 11:14 (= SGPA 16:19) binding
- IA 40:41 (≠ LA 40:41) binding
- Q45 (= Q45) binding
- N54 (= N54) binding
- V87 (≠ I87) binding
- C142 (= C138) modified: Disulfide link with 145, Redox-active
- C145 (= C141) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D288) binding
- RQA 295:297 (= RQA 295:297) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
47% identity, 94% coverage: 8:319/333 of query aligns to 2:318/318 of 3d8xA
- active site: C141 (= C138), C144 (= C141), D145 (= D142)
- binding flavin-adenine dinucleotide: I8 (≠ L14), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), Y31 (vs. gap), G33 (vs. gap), A36 (≠ V37), I39 (≠ L40), G43 (= G44), Q44 (= Q45), I51 (≠ V52), N53 (= N54), T85 (≠ H86), V86 (≠ I87), T118 (= T115), G119 (= G116), C144 (= C141), G286 (= G287), D287 (= D288), R294 (= R295), Q295 (= Q296), A296 (= A297), S299 (= S300)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L122), G160 (= G155), S164 (≠ T159), R184 (= R179), K185 (≠ R180), R189 (= R184), I247 (= I245)
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
47% identity, 94% coverage: 8:319/333 of query aligns to 3:319/319 of 3itjB
- active site: C142 (= C138), C145 (= C141), D146 (= D142)
- binding flavin-adenine dinucleotide: I9 (≠ L14), G10 (= G15), S11 (= S16), G12 (= G17), P13 (= P18), A14 (= A19), Y32 (vs. gap), E33 (vs. gap), G34 (vs. gap), A37 (≠ V37), I40 (≠ L40), A41 (= A41), G44 (= G44), Q45 (= Q45), T49 (= T49), I52 (≠ V52), N54 (= N54), T86 (≠ H86), V87 (≠ I87), T119 (= T115), G120 (= G116), W135 (≠ M131), C145 (= C141), G287 (= G287), D288 (= D288), R295 (= R295), Q296 (= Q296), A297 (= A297), S300 (= S300)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
46% identity, 92% coverage: 8:315/333 of query aligns to 2:319/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (≠ L14), G9 (= G15), S10 (= S16), G11 (= G17), P12 (= P18), A13 (= A19), Y31 (≠ V37), E32 (≠ T38), G33 (= G39), A36 (vs. gap), T38 (vs. gap), A39 (= A41), G42 (= G44), Q43 (= Q45), L44 (= L46), T47 (= T49), I50 (≠ V52), N52 (= N54), T84 (≠ H86), I85 (= I87), T120 (= T115), G121 (= G116), C146 (= C141), G291 (= G287), D292 (= D288), R299 (= R295), Q300 (= Q296), A301 (= A297), S304 (= S300)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G156), G164 (= G157), S166 (≠ T159), R186 (= R179), R187 (= R180), R191 (= R184), V252 (≠ I245)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
43% identity, 96% coverage: 11:330/333 of query aligns to 72:392/515 of Q70G58
- C203 (= C138) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C141) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A160) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ H178) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R179) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
Query Sequence
>BPHYT_RS05070 FitnessBrowser__BFirm:BPHYT_RS05070
MPATSTKHAKVLILGSGPAGYTAAVYAARANLAPVLVTGLAQGGQLMTTTDVENWPADPN
GVQGPELMTRFLEHAERFNTEIIFDHIHTAKLDEKPIRLIGDSGEYTCDSLIISTGASAQ
YLGLPSEEAFMGKGVSACATCDGFFYKQQHVAVIGGGNTAVEEALYLSGIARKVTVIHRR
DKFRAEPILIDRLLAKEKEGLVEIKWDSTLDEVTGDQSGVTGLRIKNTKTGATEDIALQG
IFVAIGHKPNTDIFAGQLEMKNGYIITKGGLNGFATATSVAGVFAAGDVQDHVYRQAITS
AGTGCMAALDAQRYLETIDEMAGEHAMSQEAER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory