Comparing BPHYT_RS05090 FitnessBrowser__BFirm:BPHYT_RS05090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
72% identity, 94% coverage: 16:325/329 of query aligns to 4:316/316 of 3nioA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
72% identity, 94% coverage: 16:325/329 of query aligns to 7:319/319 of Q9I3S3
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
48% identity, 94% coverage: 11:319/329 of query aligns to 2:310/318 of Q9I6K2
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
48% identity, 93% coverage: 13:319/329 of query aligns to 1:307/315 of 3niqA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
48% identity, 93% coverage: 13:319/329 of query aligns to 2:308/316 of 3nipB
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
39% identity, 89% coverage: 24:316/329 of query aligns to 2:294/301 of 1gq6B
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
38% identity, 91% coverage: 18:316/329 of query aligns to 4:302/313 of P0DJQ3
7lbaB E. Coli agmatinase (see paper)
41% identity, 81% coverage: 32:299/329 of query aligns to 26:287/310 of 7lbaB
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
41% identity, 81% coverage: 32:299/329 of query aligns to 19:280/306 of P60651
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
41% identity, 81% coverage: 32:299/329 of query aligns to 9:270/294 of 7lolA
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
40% identity, 93% coverage: 13:318/329 of query aligns to 15:314/323 of 4dz4B
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
40% identity, 81% coverage: 32:299/329 of query aligns to 5:260/284 of 7loxA
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
35% identity, 92% coverage: 18:319/329 of query aligns to 46:354/378 of 7esrA
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
35% identity, 88% coverage: 27:317/329 of query aligns to 8:296/303 of 1wogA
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
28% identity, 82% coverage: 50:320/329 of query aligns to 11:272/276 of 3lhlA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 84% coverage: 42:319/329 of query aligns to 19:283/284 of Q57757
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
32% identity, 82% coverage: 47:315/329 of query aligns to 42:312/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 82% coverage: 47:315/329 of query aligns to 66:336/342 of P46637
Sites not aligning to the query:
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
34% identity, 80% coverage: 50:311/329 of query aligns to 29:277/293 of 3pzlB
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
30% identity, 91% coverage: 18:315/329 of query aligns to 25:311/317 of 6vstA
>BPHYT_RS05090 FitnessBrowser__BFirm:BPHYT_RS05090
MNTSSFISPEAGERPQPLSGNAMPRCGGIATMMRLPNVGSAEGFDACFVGVPFDLGTSNR
TGARFGPRQIRSESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNLHDSIKRIETAYDE
ILQHDCKPITLGGDHTIALPILRAIHRKHGKVGLIHVDAHADVNDTMMGEKIAHGTPFRR
AVEEGLLDCDRVVQIGLRGTGYAAEDFDWCRDQGFEVVQAEACWNQSLVPLMARIRERMG
DGPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGSRGLNIVGCDLVEVAPPYDP
FGTTALLGANLAFELLCVLPGVEYRASTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory