SitesBLAST
Comparing BPHYT_RS06720 FitnessBrowser__BFirm:BPHYT_RS06720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
28% identity, 93% coverage: 1:349/375 of query aligns to 1:357/379 of 1ukwB
- active site: L124 (≠ F125), S125 (≠ H126), T241 (≠ G231)
- binding cobalt (ii) ion: D145 (≠ E146), H146 (≠ Q147)
- binding flavin-adenine dinucleotide: F122 (≠ M123), L124 (≠ F125), S125 (≠ H126), G130 (≠ R131), S131 (≠ Y132), W155 (≠ V156), S157 (≠ Q158), K200 (≠ I196), L357 (≠ I349)
Sites not aligning to the query:
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
28% identity, 93% coverage: 1:349/375 of query aligns to 1:357/379 of 1ukwA
Sites not aligning to the query:
6cxtB Crystal structure of fad-dependent dehydrogenase (see paper)
29% identity, 90% coverage: 1:337/375 of query aligns to 1:338/372 of 6cxtB
- active site: I117 (≠ F125), S118 (≠ H126), E234 (≠ G231)
- binding flavin-adenine dinucleotide: N115 (≠ M123), I117 (≠ F125), S118 (≠ H126), G123 (≠ R131), S124 (≠ Y132), Y148 (≠ V156), T150 (≠ Q158), L201 (= L204)
- binding S-[2-({N-[(2R)-2-hydroxy-4-{[(R)-hydroxy(oxo)-lambda~5~-phosphanyl]oxy}-3,3-dimethylbutanoyl]-beta-alanyl}amino)ethyl] 1H-pyrrole-2-carbothioate: A81 (≠ V92), N115 (≠ M123), S124 (≠ Y132), F227 (≠ L224), M231 (≠ A228), E234 (≠ G231), R235 (≠ T232)
Sites not aligning to the query:
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
28% identity, 98% coverage: 1:367/375 of query aligns to 1:357/364 of 6wy8C
6cy8B Crystal structure of fad-dependent dehydrogenase (see paper)
29% identity, 90% coverage: 1:337/375 of query aligns to 1:336/370 of 6cy8B
- active site: I115 (≠ F125), S116 (≠ H126), E232 (≠ G231)
- binding flavin-adenine dinucleotide: N113 (vs. gap), I115 (≠ F125), S116 (≠ H126), G121 (≠ R131), S122 (≠ Y132), Y146 (≠ V156), T148 (≠ Q158), L199 (= L204)
- binding 4'-phosphopantetheine: S122 (≠ Y132), F225 (≠ L224), A226 (≠ E225), R233 (≠ T232)
Sites not aligning to the query:
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
28% identity, 97% coverage: 4:367/375 of query aligns to 1:354/361 of 6wy9B
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
28% identity, 79% coverage: 51:345/375 of query aligns to 46:349/374 of 5lnxD
- active site: L122 (≠ F125), T123 (≠ H126), G239 (= G231)
- binding flavin-adenine dinucleotide: L122 (≠ F125), T123 (≠ H126), G128 (≠ R131), S129 (≠ Y132), F153 (≠ V156), T155 (≠ Q158), R265 (= R257), Q267 (= Q259), F268 (= F260), I272 (= I264), N275 (≠ F267), I278 (≠ L270), Q331 (= Q327), I332 (≠ L328), G335 (= G331)
Sites not aligning to the query:
7p9xA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1-ene-1-carboxyl-coa (see paper)
30% identity, 78% coverage: 47:337/375 of query aligns to 42:344/378 of 7p9xA
- binding 1-monoenoyl-CoA: L82 (≠ Y87), D89 (vs. gap), S129 (≠ Y132), L131 (= L134), K176 (≠ G174), F229 (≠ A221), M233 (≠ E225), L236 (≠ A228), R240 (≠ T232)
- binding flavin-adenine dinucleotide: A122 (≠ F125), T123 (≠ H126), G128 (≠ R131), S129 (≠ Y132), F153 (≠ V156), I154 (≠ V157), T155 (≠ Q158), N206 (vs. gap)
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
26% identity, 95% coverage: 1:355/375 of query aligns to 1:364/380 of 4l1fA
- active site: L125 (≠ F125), T126 (≠ H126), G242 (= G231), E363 (≠ L354)
- binding coenzyme a persulfide: T132 (≠ Y132), H179 (vs. gap), F232 (≠ A221), M236 (≠ E225), E237 (≠ H226), L239 (≠ A228), D240 (= D229), R243 (≠ T232), Y362 (≠ T353), E363 (≠ L354), G364 (= G355)
- binding flavin-adenine dinucleotide: F123 (≠ M123), L125 (≠ F125), T126 (≠ H126), G131 (≠ R131), T132 (≠ Y132), F156 (≠ V156), I157 (≠ V157), T158 (≠ Q158), R268 (= R257), Q270 (= Q259), F271 (= F260), I275 (= I264), F278 (= F267), L281 (= L270), Q336 (= Q327), I337 (≠ L328), G340 (= G331), I358 (= I349), Y362 (≠ T353)
- binding 1,3-propandiol: L5 (≠ F5), Q10 (= Q10)
Sites not aligning to the query:
7p9aA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1,5-diene-1-carboxyl-coa (see paper)
30% identity, 78% coverage: 47:337/375 of query aligns to 44:346/380 of 7p9aA
- binding 1,5 Dienoyl-CoA: S131 (≠ Y132), L133 (= L134), K178 (≠ G174), F231 (≠ A221), M235 (≠ E225), L238 (≠ A228), N241 (≠ G231), R242 (≠ T232)
- binding flavin-adenine dinucleotide: L122 (≠ M123), A124 (≠ F125), T125 (≠ H126), G130 (≠ R131), S131 (≠ Y132), F155 (≠ V156), I156 (≠ V157), T157 (≠ Q158), K200 (≠ I196), N208 (vs. gap)
Sites not aligning to the query:
7szvA Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
27% identity, 86% coverage: 45:365/375 of query aligns to 40:367/372 of 7szvA
- binding dihydroflavine-adenine dinucleotide: L122 (≠ F125), T123 (≠ H126), F153 (≠ V156), I154 (≠ V157), T155 (≠ Q158), K194 (≠ I196), R261 (= R257), S263 (≠ Q259), Y271 (≠ F267), I274 (≠ L270), Q329 (= Q327), V330 (≠ L328), G332 (= G330), G333 (= G331), T358 (≠ D356), E360 (≠ D358)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
27% identity, 81% coverage: 51:355/375 of query aligns to 48:363/378 of 5ol2F
- active site: L124 (≠ F125), T125 (≠ H126), G241 (= G231)
- binding coenzyme a persulfide: L238 (≠ A228), R242 (≠ T232), E362 (≠ L354), G363 (= G355)
- binding flavin-adenine dinucleotide: F122 (≠ M123), L124 (≠ F125), T125 (≠ H126), P127 (= P128), T131 (≠ Y132), F155 (≠ V156), I156 (≠ V157), T157 (≠ Q158), E198 (≠ T191), R267 (= R257), F270 (= F260), L274 (≠ I264), F277 (= F267), Q335 (= Q327), L336 (= L328), G338 (= G330), G339 (= G331), Y361 (≠ T353)
Sites not aligning to the query:
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
27% identity, 92% coverage: 5:349/375 of query aligns to 5:359/380 of 2pg0A
- active site: M124 (≠ F125), T125 (≠ H126), E243 (≠ G231)
- binding flavin-adenine dinucleotide: I122 (≠ M123), M124 (≠ F125), T125 (≠ H126), G130 (≠ R131), S131 (≠ Y132), F155 (≠ V156), I156 (≠ V157), T157 (≠ Q158), R269 (= R257), F272 (= F260), F279 (= F267), Q337 (= Q327), L338 (= L328), G340 (= G330), G341 (= G331), V359 (≠ I349)
Sites not aligning to the query:
6af6A Piga with fad and proline (see paper)
24% identity, 93% coverage: 1:347/375 of query aligns to 1:359/383 of 6af6A
- active site: A127 (≠ F125), T128 (≠ H126), A244 (≠ G231)
- binding flavin-adenine dinucleotide: N125 (≠ M123), A127 (≠ F125), T128 (≠ H126), G133 (≠ R131), S134 (≠ Y132), F158 (≠ V156), I159 (≠ V157), T160 (≠ Q158), W211 (≠ A201)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L41 (≠ H43), K44 (≠ A46), K275 (≠ Q262), F280 (= F267)
- binding proline: G133 (≠ R131), I136 (≠ L134), F237 (≠ L224), M241 (≠ A228)
Sites not aligning to the query:
7w0jE Acyl-coa dehydrogenase, tfu_1647
29% identity, 80% coverage: 57:355/375 of query aligns to 57:367/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ H126), W157 (≠ V156), R270 (= R257), Q272 (= Q259), F273 (= F260), I277 (= I264), F280 (= F267), I283 (≠ L270), Q339 (= Q327), L340 (= L328), G343 (= G331), Y365 (≠ T353), E366 (≠ L354)
Sites not aligning to the query:
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: 368, 370, 371
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
29% identity, 80% coverage: 57:355/375 of query aligns to 56:366/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (≠ Y132), T134 (≠ L134), R180 (vs. gap), R234 (≠ A222), L237 (≠ E225), R238 (≠ H226), L240 (≠ A228), D241 (= D229), R244 (≠ T232), E365 (≠ L354), G366 (= G355)
- binding flavin-adenine dinucleotide: Y123 (≠ M123), L125 (≠ F125), S126 (≠ H126), G131 (≠ R131), S132 (≠ Y132), W156 (≠ V156), I157 (≠ V157), T158 (≠ Q158), I360 (= I349)
Sites not aligning to the query:
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
29% identity, 80% coverage: 57:355/375 of query aligns to 56:366/381 of 8i4pA
Sites not aligning to the query:
4x28D Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
27% identity, 97% coverage: 1:364/375 of query aligns to 1:355/364 of 4x28D
Sites not aligning to the query:
4irnA Crystal structure of the prolyl acyl carrier protein oxidase anab (see paper)
24% identity, 89% coverage: 5:336/375 of query aligns to 2:345/378 of 4irnA
- active site: A124 (≠ F125), T125 (≠ H126), E241 (≠ G231)
- binding flavin-adenine dinucleotide: H122 (≠ M123), A124 (≠ F125), T125 (≠ H126), G130 (≠ R131), S131 (≠ Y132), Y155 (≠ V156), T157 (≠ Q158), H267 (≠ R257), Q269 (= Q259), F270 (= F260), I274 (= I264), F277 (= F267), V280 (≠ L270), E335 (≠ Q327), I336 (≠ L328), G338 (= G330), A339 (≠ G331)
Sites not aligning to the query:
2uxwA Crystal structure of human very long chain acyl-coa dehydrogenase (acadvl)
25% identity, 98% coverage: 4:369/375 of query aligns to 25:408/567 of 2uxwA
- active site: L148 (≠ F125), T149 (≠ H126), G272 (= G231), E394 (≠ L354), L406 (= L367)
- binding flavin-adenine dinucleotide: F146 (≠ M123), L148 (≠ F125), T149 (≠ H126), G154 (≠ R131), S155 (≠ Y132), W181 (≠ V156), I182 (≠ V157), S183 (≠ Q158), F393 (≠ T353), T396 (≠ D356), D398 (= D358), I399 (≠ H360)
- binding trans delta2 palmitenoyl-coenzymea: V96 (vs. gap), G107 (≠ A81), L110 (≠ V84), F146 (≠ M123), L269 (≠ A228), F393 (≠ T353), E394 (≠ L354), G395 (= G355)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS06720 FitnessBrowser__BFirm:BPHYT_RS06720
MDFTFNDEQQQFADALRRYLDKSYGFEARQATVRSETGVSDAHWAAFSELGLTALPVPEA
QGGFNGGPIDMLVVMQELGRALVVEPYWATAVGIEALRLAGSDQGEDASLLERAAQGEIK
LAMAFHEPHARYDLFAVETSANGQGEQLTLTGKKSVVQHGAQADYWIVPARLNGEIALFV
VARNAAGVEITDYRTIDGQRAATLEFNNTPARRLAGKHAGAAALEHIADYGTVLLCAEAI
GALDALNLATVDYTKTRQQFGQPIARFQALQHRMVEMLIHAEQARSVTYLAAMRYTSMDA
DERRRAVSAAKARVGQAARFVGQQAVQLHGGMGVTNEVAAAHLFKRLAIIETTLGDVDHH
LARFAALPGFVTAEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory