SitesBLAST
Comparing BPHYT_RS06755 FitnessBrowser__BFirm:BPHYT_RS06755 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
31% identity, 96% coverage: 11:262/262 of query aligns to 8:257/259 of 5zaiC
- active site: A65 (≠ G67), F70 (vs. gap), S82 (= S81), R86 (≠ E85), G110 (≠ A115), E113 (≠ S118), P132 (≠ S137), E133 (≠ Y138), I138 (≠ L143), P140 (= P145), G141 (≠ D146), A226 (≠ V231), F236 (≠ L241)
- binding coenzyme a: K24 (≠ A26), L25 (≠ R27), A63 (= A65), G64 (= G66), A65 (≠ G67), D66 (≠ N68), I67 (≠ L69), P132 (≠ S137), R166 (≠ P171), F248 (= F253), K251 (= K256)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
30% identity, 98% coverage: 5:262/262 of query aligns to 4:256/258 of 1ey3A
- active site: A66 (≠ G67), M71 (≠ L72), S81 (= S86), L85 (= L90), G109 (≠ A115), E112 (≠ S118), P131 (≠ S137), E132 (≠ Y138), T137 (≠ L143), P139 (= P145), G140 (≠ D146), K225 (≠ V231), F235 (≠ L241)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ G25), L26 (≠ R27), A28 (= A29), A64 (= A65), G65 (= G66), A66 (≠ G67), D67 (≠ N68), I68 (≠ L69), L85 (= L90), W88 (= W93), G109 (≠ A115), P131 (≠ S137), L135 (≠ V141), G140 (≠ D146)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
30% identity, 98% coverage: 5:262/262 of query aligns to 6:258/260 of 1dubA
- active site: A68 (≠ G67), M73 (≠ L72), S83 (= S86), L87 (= L90), G111 (≠ A115), E114 (≠ S118), P133 (≠ S137), E134 (≠ Y138), T139 (≠ L143), P141 (= P145), G142 (≠ D146), K227 (≠ V231), F237 (≠ L241)
- binding acetoacetyl-coenzyme a: K26 (≠ G25), A27 (= A26), L28 (≠ R27), A30 (= A29), A66 (= A65), A68 (≠ G67), D69 (≠ N68), I70 (≠ L69), Y107 (≠ A111), G110 (= G114), G111 (≠ A115), E114 (≠ S118), P133 (≠ S137), E134 (≠ Y138), L137 (≠ V141), G142 (≠ D146), F233 (= F237), F249 (= F253)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 98% coverage: 5:262/262 of query aligns to 36:288/290 of P14604
- E144 (≠ S118) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ Y138) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
32% identity, 94% coverage: 16:262/262 of query aligns to 18:264/266 of O53561
- K135 (= K133) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 133:140, 50% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (≠ R140) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
30% identity, 98% coverage: 5:262/262 of query aligns to 5:252/254 of 2dubA
- active site: A67 (≠ G67), M72 (≠ L72), S82 (≠ G91), G105 (≠ A115), E108 (≠ S118), P127 (≠ S137), E128 (≠ Y138), T133 (≠ L143), P135 (= P145), G136 (≠ D146), K221 (≠ V231), F231 (≠ L241)
- binding octanoyl-coenzyme a: K25 (≠ G25), A26 (= A26), L27 (≠ R27), A29 (= A29), A65 (= A65), A67 (≠ G67), D68 (≠ N68), I69 (≠ L69), K70 (≠ N70), G105 (≠ A115), E108 (≠ S118), P127 (≠ S137), E128 (≠ Y138), G136 (≠ D146), A137 (≠ G147)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
30% identity, 98% coverage: 5:262/262 of query aligns to 6:256/258 of 1mj3A
- active site: A68 (≠ G67), M73 (≠ L72), S83 (≠ Q83), L85 (= L90), G109 (≠ A115), E112 (≠ S118), P131 (≠ S137), E132 (≠ Y138), T137 (≠ L143), P139 (= P145), G140 (≠ D146), K225 (≠ V231), F235 (≠ L241)
- binding hexanoyl-coenzyme a: K26 (≠ G25), A27 (= A26), L28 (≠ R27), A30 (= A29), A66 (= A65), G67 (= G66), A68 (≠ G67), D69 (≠ N68), I70 (≠ L69), G109 (≠ A115), P131 (≠ S137), E132 (≠ Y138), L135 (≠ V141), G140 (≠ D146)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
35% identity, 94% coverage: 18:262/262 of query aligns to 17:259/261 of 5jbxB
- active site: A67 (≠ G67), R72 (≠ P80), L84 (≠ I87), R88 (≠ G91), G112 (≠ A115), E115 (≠ S118), T134 (≠ S137), E135 (≠ Y138), I140 (≠ L143), P142 (= P145), G143 (≠ D146), A228 (≠ V231), L238 (= L241)
- binding coenzyme a: S24 (≠ G25), R25 (≠ A26), R26 (= R27), A28 (= A29), A65 (= A65), D68 (≠ N68), L69 (= L69), K70 (= K78), L110 (≠ A113), G111 (= G114), T134 (≠ S137), E135 (≠ Y138), L138 (≠ V141), R168 (≠ P171)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
29% identity, 98% coverage: 5:262/262 of query aligns to 6:258/260 of 2hw5C
- active site: A68 (≠ G67), M73 (≠ L72), S83 (= S86), L87 (= L90), G111 (≠ A115), E114 (≠ S118), P133 (≠ S137), E134 (≠ Y138), T139 (≠ L143), P141 (= P145), G142 (≠ D146), K227 (≠ V231), F237 (≠ L241)
- binding crotonyl coenzyme a: K26 (≠ G25), A27 (= A26), L28 (≠ R27), A30 (= A29), K62 (≠ N61), I70 (≠ L69), F109 (≠ A113)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
30% identity, 93% coverage: 18:261/262 of query aligns to 16:254/255 of 3q0jC
- active site: A65 (≠ G67), M70 (≠ L72), T80 (≠ S86), F84 (≠ L90), G108 (≠ A115), E111 (≠ S118), P130 (≠ S137), E131 (≠ Y138), V136 (≠ L143), P138 (= P145), G139 (≠ D146), L224 (≠ V231), F234 (≠ L241)
- binding acetoacetyl-coenzyme a: Q23 (≠ G25), A24 (= A26), L25 (≠ R27), A27 (= A29), A63 (= A65), G64 (= G66), A65 (≠ G67), D66 (≠ N68), I67 (≠ L69), K68 (≠ N70), M70 (≠ L72), F84 (≠ L90), G107 (= G114), G108 (≠ A115), E111 (≠ S118), P130 (≠ S137), E131 (≠ Y138), P138 (= P145), G139 (≠ D146), M140 (≠ G147)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 93% coverage: 18:261/262 of query aligns to 16:254/255 of 3q0gC
- active site: A65 (≠ G67), M70 (≠ L72), T80 (≠ S86), F84 (≠ L90), G108 (≠ A115), E111 (≠ S118), P130 (≠ S137), E131 (≠ Y138), V136 (≠ L143), P138 (= P145), G139 (≠ D146), L224 (≠ V231), F234 (≠ L241)
- binding coenzyme a: L25 (≠ R27), A63 (= A65), I67 (≠ L69), K68 (≠ N70), Y104 (≠ A111), P130 (≠ S137), E131 (≠ Y138), L134 (≠ V141)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 93% coverage: 18:261/262 of query aligns to 15:249/250 of 3q0gD
- active site: A64 (≠ G67), M69 (≠ L72), T75 (≠ S86), F79 (≠ L90), G103 (≠ A115), E106 (≠ S118), P125 (≠ S137), E126 (≠ Y138), V131 (≠ L143), P133 (= P145), G134 (≠ D146), L219 (≠ V231), F229 (≠ L241)
- binding Butyryl Coenzyme A: F225 (= F237), F241 (= F253)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
30% identity, 93% coverage: 18:261/262 of query aligns to 15:253/256 of 3h81A
- active site: A64 (≠ G67), M69 (≠ L72), T79 (≠ S86), F83 (≠ L90), G107 (≠ A115), E110 (≠ S118), P129 (≠ S137), E130 (≠ Y138), V135 (≠ L143), P137 (= P145), G138 (≠ D146), L223 (≠ V231), F233 (≠ L241)
- binding calcium ion: F233 (≠ L241), Q238 (≠ G246)
7borA Structure of pseudomonas aeruginosa coa-bound odaa (see paper)
33% identity, 92% coverage: 17:256/262 of query aligns to 13:247/247 of 7borA
- active site: N63 (≠ G67), F68 (≠ L72), D77 (≠ A84), G81 (= G91), I105 (≠ A115), T108 (≠ S118), F128 (≠ Y138), L133 (= L143), P135 (= P145), E136 (≠ D146), A222 (≠ V231), L232 (= L241)
- binding coenzyme a: D21 (≠ G25), K22 (≠ A26), A25 (= A29), S61 (≠ A65), I65 (≠ L69), V103 (≠ A113), F128 (≠ Y138), L131 (≠ V141), F244 (= F253), R247 (≠ K256)
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
31% identity, 93% coverage: 19:261/262 of query aligns to 21:253/260 of 2uzfA
- active site: G70 (= G67), R80 (≠ Q83), L84 (≠ I87), G108 (≠ A115), V111 (≠ S118), T130 (≠ S137), G131 (≠ Y138), S136 (≠ L143), D138 (≠ P145), A139 (≠ D146), A225 (= A227), Y233 (≠ L241)
- binding acetoacetyl-coenzyme a: V28 (≠ A26), R29 (= R27), S68 (≠ A65), G69 (= G66), G70 (= G67), D71 (≠ N68), Y104 (≠ A111), G108 (≠ A115)
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
31% identity, 93% coverage: 19:261/262 of query aligns to 26:266/273 of Q5HH38
- R34 (= R27) binding in other chain
- SGGDQ 73:77 (≠ AGGNL 65:69) binding in other chain
- S149 (≠ L143) binding in other chain
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
32% identity, 95% coverage: 13:262/262 of query aligns to 10:255/257 of 6slbAAA
- active site: Q64 (≠ G67), F69 (≠ L72), L80 (≠ A84), N84 (≠ D88), A108 (= A115), S111 (= S118), A130 (≠ S137), F131 (≠ Y138), L136 (= L143), P138 (= P145), D139 (= D146), A224 (≠ V231), G234 (≠ L241)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ N61), A62 (= A65), Q64 (≠ G67), D65 (≠ N68), L66 (= L69), Y76 (≠ P80), A108 (= A115), F131 (≠ Y138), D139 (= D146)
4elxA Structure of apo e.Coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl (see paper)
29% identity, 93% coverage: 19:261/262 of query aligns to 34:261/268 of 4elxA
- active site: G83 (= G67), H88 (≠ S86), L92 (= L90), G116 (≠ A115), V119 (≠ S118), G139 (≠ Y138), S144 (≠ L143), D146 (≠ P145), G147 (≠ D146), A233 (= A227), Y241 (≠ L241)
- binding chloride ion: G115 (= G114), G139 (≠ Y138), W167 (≠ L166)
3t88A Crystal structure of escherichia coli menb in complex with substrate analogue, osb-ncoa (see paper)
28% identity, 93% coverage: 19:261/262 of query aligns to 33:274/281 of 3t88A
- active site: G82 (= G67), R87 (≠ L72), Y93 (≠ K78), H101 (≠ S86), L105 (= L90), G129 (≠ A115), V132 (≠ S118), G152 (≠ Y138), S157 (≠ L143), D159 (≠ P145), G160 (≠ D146), A246 (= A227), Y254 (≠ L241)
- binding o-succinylbenzoyl-N-coenzyme A: Q39 (≠ G25), V40 (≠ A26), R41 (= R27), A43 (= A29), S80 (≠ A65), G81 (= G66), G82 (= G67), D83 (≠ N68), Q84 (≠ L69), K85 (≠ N70), Y93 (≠ K78), V104 (≠ L89), L105 (= L90), Y125 (≠ A111), G129 (≠ A115), T151 (≠ S137), V155 (= V141), F158 (≠ T144), D159 (≠ P145), T250 (≠ F237), Y254 (≠ L241), F266 (= F253), K269 (= K256)
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
28% identity, 93% coverage: 19:261/262 of query aligns to 37:278/285 of 4i42A
- active site: G86 (= G67), R91 (≠ L72), Y97 (≠ K78), H105 (≠ S86), L109 (= L90), G133 (≠ A115), V136 (≠ S118), G156 (≠ Y138), S161 (≠ L143), D163 (≠ P145), G164 (≠ D146), A250 (= A227), Y258 (≠ L241)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (≠ A26), R45 (= R27), S84 (≠ A65), G85 (= G66), G86 (= G67), D87 (≠ N68), Q88 (≠ L69), K89 (≠ N70), Y97 (≠ K78), V108 (≠ L89), Y129 (≠ A111), G133 (≠ A115), T155 (≠ S137), S161 (≠ L143), T254 (≠ F237), F270 (= F253), K273 (= K256)
Query Sequence
>BPHYT_RS06755 FitnessBrowser__BFirm:BPHYT_RS06755
MSAELLTSRPTESESTLVLTLSNPGARNALHPDMYAAGIEALDSVERDASIRAVVITGAD
NFFCAGGNLNRLLENRAKDPSVQAESIDLLGEWISAVRLSSKPVIAAVDGAAAGAGFSLA
LACDLIVAADEAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGATRLHEL
GVVNKLAKTGAVRDAAVAWADELGKISPNSVARIKGLISAAGAQPLADHLVAERDSFVAS
LHHREGLEGISAFLEKRAPVYK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory