Comparing BPHYT_RS07185 FitnessBrowser__BFirm:BPHYT_RS07185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
44% identity, 88% coverage: 6:163/180 of query aligns to 3:164/165 of 2vi7C
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
32% identity, 88% coverage: 3:160/180 of query aligns to 1:160/164 of 2ge3A
3ld2B The crystal structure of smu.2055 from streptococcus mutans ua159
33% identity, 65% coverage: 39:155/180 of query aligns to 34:150/162 of 3ld2B
Sites not aligning to the query:
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
32% identity, 61% coverage: 54:162/180 of query aligns to 60:170/171 of 2i79A
Sites not aligning to the query:
Q9NHD5 Probable N-acetyltransferase san; N-epsilon-acetyltransferase san; Protein atado; Protein separation anxiety; EC 2.3.1.258; EC 2.3.1.- from Drosophila melanogaster (Fruit fly) (see paper)
30% identity, 53% coverage: 45:139/180 of query aligns to 36:131/184 of Q9NHD5
4pv6G Crystal structure analysis of ard1 from thermoplasma volcanium (see paper)
36% identity, 51% coverage: 50:141/180 of query aligns to 42:130/154 of 4pv6G
Sites not aligning to the query:
4pv6A Crystal structure analysis of ard1 from thermoplasma volcanium (see paper)
36% identity, 51% coverage: 50:141/180 of query aligns to 42:130/154 of 4pv6A
Q9ZV08 GCN5-related N-acetyltransferase 4, chloroplastic; N-alpha-acetyltransferase 70; AtNAA70; EC 2.3.1.255; EC 2.3.1.48 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 51% coverage: 46:137/180 of query aligns to 162:250/291 of Q9ZV08
Sites not aligning to the query:
6tgxA Crystal structure of arabidopsis thaliana naa60 in complex with a bisubstrate analogue (see paper)
26% identity, 74% coverage: 27:160/180 of query aligns to 35:168/174 of 6tgxA
Sites not aligning to the query:
6th0A Crystal structure of arabidopsis thaliana naa60 in complex with acetyl-coa (see paper)
31% identity, 48% coverage: 74:160/180 of query aligns to 85:171/176 of 6th0A
Sites not aligning to the query:
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
28% identity, 54% coverage: 64:161/180 of query aligns to 65:163/185 of 4jxrB
Sites not aligning to the query:
>BPHYT_RS07185 FitnessBrowser__BFirm:BPHYT_RS07185
MPEGLTLRALRVADAEQFHAMLQLPVAMNGNPQMPFRTVASTREYLEKFEAPGIAIAATV
ADTLVGQASLSPFKGRRAHAASLGIGVHDAWQRRGIGRALMAELLDLADNWLGLRRVELH
VYADNHAALALYRKFGFEIEAHQRGSVLRRGVLIDCYFMARLREPAPWMSPPSAAHLAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory