Comparing BPHYT_RS07190 FitnessBrowser__BFirm:BPHYT_RS07190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
45% identity, 84% coverage: 21:168/177 of query aligns to 14:163/165 of 2vi7C
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
46% identity, 60% coverage: 61:166/177 of query aligns to 55:160/164 of 2ge3A
Sites not aligning to the query:
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
34% identity, 62% coverage: 60:169/177 of query aligns to 60:171/171 of 2i79A
Sites not aligning to the query:
3f8kA Crystal structure of protein acetyltransferase (pat) from sulfolobus solfataricus (see paper)
35% identity, 50% coverage: 55:143/177 of query aligns to 35:115/131 of 3f8kA
Sites not aligning to the query:
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
29% identity, 84% coverage: 25:173/177 of query aligns to 8:169/172 of A6VCX3
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
29% identity, 84% coverage: 25:173/177 of query aligns to 7:168/171 of 2j8mA
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
29% identity, 84% coverage: 25:173/177 of query aligns to 6:167/170 of 2j8rA
Q8ZJW4 [Ribosomal protein bS18]-alanine N-acetyltransferase; EC 2.3.1.266 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 58% coverage: 51:152/177 of query aligns to 27:129/148 of Q8ZJW4
2cnsA Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with acetylcoa. (see paper)
32% identity, 58% coverage: 51:152/177 of query aligns to 27:129/151 of 2cnsA
Sites not aligning to the query:
2cnmA Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (cterm-arg-arg-phe-tyr-arg-ala-n-alpha- acetyl-s-coa). (see paper)
32% identity, 58% coverage: 51:152/177 of query aligns to 27:129/151 of 2cnmA
Sites not aligning to the query:
P0A944 [Ribosomal protein bS18]-alanine N-acetyltransferase; KAT; Peptidyl-lysine N-acetyltransferase; EC 2.3.1.266; EC 2.3.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 58% coverage: 51:152/177 of query aligns to 27:129/148 of P0A944
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
31% identity, 67% coverage: 51:169/177 of query aligns to 45:165/165 of 4jwpA
Sites not aligning to the query:
>BPHYT_RS07190 FitnessBrowser__BFirm:BPHYT_RS07190
MPDDAAHYKCIMVRALESSDMDAFAEIMSLPGVRRGTLSVGYRSPEQLAAWYERRLKGGV
NVCATIDGRVIGHASLEVHRSSRAHSAHLGLAVHDAYHRRGVGAALLQGLIDCADASFGL
RRIDLTVFADNAPAIALYRKFGFVEEGRSRGFAVRDGVLADVLHMARLVDAPRLQTI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory