Comparing BPHYT_RS07270 FitnessBrowser__BFirm:BPHYT_RS07270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ergA Evidence for a dual role of an active site histidine in alpha-amino- beta-carboxymuconate-epsilon-semialdehyde decarboxylase (see paper)
70% identity, 97% coverage: 4:334/340 of query aligns to 3:332/332 of 4ergA
4eraA Evidence for a dual role of an active site histidine in alpha-amino- beta-carboxymuconate-epsilon-semialdehyde decarboxylase (see paper)
70% identity, 97% coverage: 4:334/340 of query aligns to 3:332/332 of 4eraA
7k13C Acmsd in complex with diflunisal derivative 14 (see paper)
71% identity, 97% coverage: 4:332/340 of query aligns to 3:330/331 of 7k13C
7k12A Acmsd in complex with diflunisal (see paper)
71% identity, 97% coverage: 4:332/340 of query aligns to 3:330/331 of 7k12A
2hbvA Crystal structure of alpha-amino-beta-carboxymuconate-epsilon- semialdehyde-decarboxylase (acmsd) (see paper)
71% identity, 97% coverage: 4:332/340 of query aligns to 3:330/331 of 2hbvA
4ofcA 2.0 angstroms x-ray crystal structure of human 2-amino-3- carboxymuconate-6-semialdehye decarboxylase (see paper)
40% identity, 97% coverage: 3:332/340 of query aligns to 1:330/335 of 4ofcA
4ih3A 2.5 angstroms x-ray crystal structure of of human 2-amino-3- carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid (see paper)
40% identity, 97% coverage: 3:332/340 of query aligns to 1:330/332 of 4ih3A
2wm1A The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis (see paper)
40% identity, 97% coverage: 3:332/340 of query aligns to 1:330/332 of 2wm1A
Q8TDX5 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; Picolinate carboxylase; EC 4.1.1.45 from Homo sapiens (Human) (see paper)
40% identity, 97% coverage: 3:332/340 of query aligns to 1:330/336 of Q8TDX5
7pwyA Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
40% identity, 97% coverage: 4:332/340 of query aligns to 1:329/334 of 7pwyA
7pwyC Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
37% identity, 97% coverage: 4:332/340 of query aligns to 1:300/301 of 7pwyC
4qrnA High-resolution crystal structure of 5-carboxyvanillate decarboxylase (target efi-505250) from novosphingobium aromaticivorans dsm 12444 complexed with manganese and 4-hydroxy-3-methoxy-5-nitrobenzoic acid
27% identity, 80% coverage: 62:332/340 of query aligns to 74:352/352 of 4qrnA
Sites not aligning to the query:
4infA Crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium
27% identity, 80% coverage: 62:332/340 of query aligns to 73:351/351 of 4infA
Sites not aligning to the query:
4hjwC Crystal structure of metarhizium anisopliae idcase in apo form (see paper)
23% identity, 86% coverage: 5:296/340 of query aligns to 10:327/378 of 4hjwC
4hk6A Crystal structure of cordyceps militaris idcase in complex with 5- nitro-uracil (see paper)
23% identity, 86% coverage: 5:296/340 of query aligns to 4:321/369 of 4hk6A
Sites not aligning to the query:
4hk5D Crystal structure of cordyceps militaris idcase in apo form (see paper)
23% identity, 86% coverage: 5:296/340 of query aligns to 5:322/380 of 4hk5D
Sites not aligning to the query:
4hk7A Crystal structure of cordyceps militaris idcase in complex with uracil (see paper)
23% identity, 86% coverage: 5:296/340 of query aligns to 4:321/379 of 4hk7A
Sites not aligning to the query:
4lalA Crystal structure of cordyceps militaris idcase d323a mutant in complex with 5-carboxyl-uracil (see paper)
23% identity, 86% coverage: 5:296/340 of query aligns to 4:321/368 of 4lalA
Q60FX6 Gamma-resorcylate decarboxylase; 2,6-dihydroxybenzoate decarboxylase; Reversible gamma-RA decarboxylase; EC 4.1.1.103 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
26% identity, 80% coverage: 61:332/340 of query aligns to 42:324/327 of Q60FX6
4ni8A Crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis complexed with mn and 5-methoxyisophtalic acid
27% identity, 79% coverage: 62:330/340 of query aligns to 60:332/335 of 4ni8A
Sites not aligning to the query:
>BPHYT_RS07270 FitnessBrowser__BFirm:BPHYT_RS07270
MTLRIDMHSHFFPPIAREEAARLDAQHAPWLQIDADGERGMIMTGEKRFRPVYRALWDPA
ARIAEMDALGVDIQLMCATPVMFGYGYGAAAAHDWAARMNDHALELCAHAPQRLMALAQV
PLQDVELACREATRAHRAGHRGVQIGNHLGPRDLDDEHLVTFLTHCANEGIPVLVHPWDM
MTDGRMKKWMLPWLVAMPAETQLSMVSLILSGAFERIPKSLKLCFAHGGGSFAFLLGRVQ
NAWEQRDIVREDCPNPPVSYLERFHVDSAVFDEGALRLLVETMGEDHVLLGSDYPFPLGE
LKIGDLVAHHPQLSETAKAKILGANAQRFFGLPVNIAHAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory