Comparing BPHYT_RS07275 FitnessBrowser__BFirm:BPHYT_RS07275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
51% identity, 100% coverage: 1:409/409 of query aligns to 1:416/416 of P83788
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
52% identity, 97% coverage: 3:397/409 of query aligns to 2:403/404 of 1qz9A
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
27% identity, 94% coverage: 10:392/409 of query aligns to 28:445/447 of 2hzpA
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
28% identity, 95% coverage: 10:398/409 of query aligns to 33:464/464 of P70712
Sites not aligning to the query:
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
27% identity, 94% coverage: 10:392/409 of query aligns to 28:444/446 of 3e9kA
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
27% identity, 94% coverage: 10:392/409 of query aligns to 33:458/465 of Q16719
Sites not aligning to the query:
7tlmA Structure of atopobium parvulum sufs (see paper)
24% identity, 57% coverage: 80:312/409 of query aligns to 75:318/415 of 7tlmA
8odqD Sufs-sufu complex from mycobacterium tuberculosis (see paper)
25% identity, 83% coverage: 54:393/409 of query aligns to 54:398/410 of 8odqD
7tlpA Structure of atopobium parvulum sufs k235r (see paper)
23% identity, 57% coverage: 80:312/409 of query aligns to 67:298/391 of 7tlpA
Sites not aligning to the query:
7tlpB Structure of atopobium parvulum sufs k235r (see paper)
23% identity, 57% coverage: 80:312/409 of query aligns to 69:300/393 of 7tlpB
Sites not aligning to the query:
Q93WX6 Cysteine desulfurase 1, chloroplastic; NIFS-like protein 1; CpNifS1; Plastid sufS-like protein; Protein AtCpNifS; Selenocysteine lyase; EC 2.8.1.7; EC 4.4.1.16 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 64% coverage: 78:340/409 of query aligns to 123:390/463 of Q93WX6
Sites not aligning to the query:
5ft8A Crystal structure of the complex between the cysteine desulfurase csda and the sulfur-acceptor csde in the persulfurated state at 2.50 angstroem resolution
26% identity, 57% coverage: 78:309/409 of query aligns to 70:307/401 of 5ft8A
Sites not aligning to the query:
Q46925 Cysteine desulfurase CsdA; Cysteine sulfinate desulfinase; CSD; Selenocysteine lyase; EC 2.8.1.7; EC 3.13.1.-; EC 4.4.1.16 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 57% coverage: 78:309/409 of query aligns to 70:307/401 of Q46925
Sites not aligning to the query:
5b87A Crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution (see paper)
24% identity, 56% coverage: 19:248/409 of query aligns to 6:242/397 of 5b87A
Sites not aligning to the query:
5b7uA Apo structure of cysteine desulfurase from thermococcus onnurineus na1 at 1.89a (see paper)
24% identity, 56% coverage: 19:248/409 of query aligns to 12:248/402 of 5b7uA
Sites not aligning to the query:
1vjoA Crystal structure of alanine--glyoxylate aminotransferase (alr1004) from nostoc sp. At 1.70 a resolution (see paper)
29% identity, 30% coverage: 130:250/409 of query aligns to 103:237/377 of 1vjoA
Sites not aligning to the query:
1t3iA Structure of slr0077/sufs, the essential cysteine desulfurase from synechocystis pcc 6803 (see paper)
23% identity, 72% coverage: 30:322/409 of query aligns to 24:314/406 of 1t3iA
Sites not aligning to the query:
Q9EXP2 Cysteine desulfurase; Selenocysteine beta-lyase; SCL; Selenocysteine lyase; Selenocysteine reductase; EC 2.8.1.7; EC 4.4.1.16 from Dickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937)) (see paper)
24% identity, 66% coverage: 31:300/409 of query aligns to 31:308/412 of Q9EXP2
Sites not aligning to the query:
P05341 Cysteine desulfurase NifS; Nitrogenase metalloclusters biosynthesis protein NifS; EC 2.8.1.7 from Azotobacter vinelandii (see 2 papers)
23% identity, 47% coverage: 30:220/409 of query aligns to 4:202/402 of P05341
Sites not aligning to the query:
3lvmB Crystal structure of e.Coli iscs (see paper)
24% identity, 43% coverage: 78:254/409 of query aligns to 62:243/394 of 3lvmB
Sites not aligning to the query:
>BPHYT_RS07275 FitnessBrowser__BFirm:BPHYT_RS07275
MITREHCAALDAADTLAHCRARFDLPADTIYLDGNSLGAMPANVPARIEQALKHEWAHGL
IRSWNDAGWYPAPQRTGNKIARLIGAGQDEVIVADSTSVNLFKVLVAATRMRPGRNVILA
ERTNFPTDVYIASSVAEMTGCDLRCVDPDEIVSAIDDTVAIVSLTHVNYKTGKRYDMEAV
TRQAQEAGALIVWDLCHSAGAMPVNLNRCDADFAVGCGYKYLNGGPGAPAFVFVASRHIE
AVRQPLTGWHGHSRPFEFAHDYAPHPGIDRMLTGTAPQLGVIALESALEAFDGVDLDVLR
DKSVALGNLFIELTDQELTGLGCTLASPRDAEMRGSQVSLGHAQGYAIMQALIARNVIGD
FRAPDILRFGFAPLYVRYVDIWDTIAQLKDIIATDAWNTDEFKARKSVT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory