Comparing BPHYT_RS07320 FitnessBrowser__BFirm:BPHYT_RS07320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 71% coverage: 5:217/302 of query aligns to 9:217/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 71% coverage: 5:217/302 of query aligns to 9:217/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 71% coverage: 5:217/302 of query aligns to 9:217/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 71% coverage: 5:217/302 of query aligns to 9:217/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 71% coverage: 5:217/302 of query aligns to 9:217/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 71% coverage: 5:217/302 of query aligns to 9:217/291 of 3pueB
Sites not aligning to the query:
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
30% identity, 89% coverage: 4:273/302 of query aligns to 9:281/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
30% identity, 89% coverage: 4:273/302 of query aligns to 9:281/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 89% coverage: 4:273/302 of query aligns to 9:281/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 89% coverage: 4:273/302 of query aligns to 9:281/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 89% coverage: 4:273/302 of query aligns to 9:281/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
30% identity, 89% coverage: 4:273/302 of query aligns to 9:281/298 of 3nevA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
27% identity, 93% coverage: 5:285/302 of query aligns to 9:288/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
25% identity, 93% coverage: 5:285/302 of query aligns to 9:288/294 of 4i7wA
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
25% identity, 94% coverage: 5:288/302 of query aligns to 9:289/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
25% identity, 94% coverage: 5:288/302 of query aligns to 9:289/296 of 7lvlA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 72% coverage: 5:220/302 of query aligns to 9:220/292 of Q07607
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
29% identity, 83% coverage: 1:252/302 of query aligns to 11:250/296 of 1xxxA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 83% coverage: 1:252/302 of query aligns to 15:254/300 of P9WP25
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
29% identity, 83% coverage: 1:252/302 of query aligns to 12:251/297 of 5j5dA
>BPHYT_RS07320 FitnessBrowser__BFirm:BPHYT_RS07320
MFAPVITPFTKDLRIDAPRFVAFCRWLVGQGAGLALFGTNSEANSLGLTERHALLDDVIK
AGVDPAHLLPGTGSCALPDAIALTRHACEAGCAGALMLPPFFYKGVSDDGLFAYYSDVIQ
AIGSDQLRVLLYHIPQFTGVPITHTLIERLITAYPRTVVGIKDSSGDWANTEAMLRKFPG
FAVFPASEALLGKALPLGAAGCISATANIQPQAIASLLNATTLEERAVWEGKVATVRLAV
QAQPMIPALKHIVAHFANDESWTRVRPPLTPMNPAQSGALLQQLQALDFSMPAMATLATV
AA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory