SitesBLAST
Comparing BPHYT_RS07405 FitnessBrowser__BFirm:BPHYT_RS07405 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
79% identity, 100% coverage: 1:339/340 of query aligns to 1:339/340 of 3enkA
- active site: S127 (= S127), S128 (= S128), T130 (= T130), Y152 (= Y152), K156 (= K156)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), G14 (= G14), Y15 (≠ F15), I16 (= I16), D35 (= D35), N36 (= N36), V38 (= V38), N39 (= N39), S40 (= S40), D62 (= D62), V63 (≠ S63), F84 (= F84), A85 (= A85), A86 (= A86), K88 (= K88), N103 (= N103), S126 (= S126), S128 (= S128), Y152 (= Y152), K156 (= K156), Y180 (= Y180), P183 (= P183)
- binding uridine-5'-diphosphate-glucose: T130 (= T130), N182 (= N182), N201 (= N201), N202 (= N202), L203 (= L203), R219 (= R219), V220 (= V220), F221 (= F221), R234 (= R234), Y236 (= Y236), V272 (= V272), R295 (= R295), D298 (= D298)
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
61% identity, 98% coverage: 6:339/340 of query aligns to 2:335/335 of 6k0iA
- active site: S124 (= S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (= I16), D31 (= D35), N32 (= N36), N35 (= N39), S36 (= S40), D58 (= D62), V59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), N99 (= N103), S122 (= S126), S123 (= S127), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate-glucose: K84 (= K88), S124 (= S128), Y149 (= Y152), F178 (= F181), N179 (= N182), A198 (≠ N201), N199 (= N202), L200 (= L203), Q216 (≠ R219), V217 (= V220), Y218 (≠ F221), R231 (= R234), Y233 (= Y236), V268 (= V272), R291 (= R295), D294 (= D298)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
61% identity, 98% coverage: 6:339/340 of query aligns to 2:335/335 of 6k0hA
- active site: S124 (= S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (= I16), D31 (= D35), N32 (= N36), G34 (≠ V38), N35 (= N39), S36 (= S40), D58 (= D62), V59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), N99 (= N103), S123 (= S127), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (= K88), S124 (= S128), Y149 (= Y152), F178 (= F181), N179 (= N182), A198 (≠ N201), N199 (= N202), L200 (= L203), Q216 (≠ R219), V217 (= V220), Y218 (≠ F221), R231 (= R234), Y233 (= Y236), V268 (= V272), R291 (= R295), D294 (= D298)
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
61% identity, 98% coverage: 6:339/340 of query aligns to 2:335/335 of 6k0gA
- active site: S124 (= S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156)
- binding magnesium ion: E66 (≠ Q70), H114 (≠ R118)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (= I16), D31 (= D35), N32 (= N36), N35 (= N39), S36 (= S40), D58 (= D62), V59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), N99 (= N103), S122 (= S126), S123 (= S127), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate: N179 (= N182), A198 (≠ N201), N199 (= N202), L200 (= L203), Q216 (≠ R219), V217 (= V220), Y218 (≠ F221), R231 (= R234), Y233 (= Y236), V268 (= V272), R291 (= R295), D294 (= D298)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
58% identity, 98% coverage: 7:339/340 of query aligns to 4:343/345 of 1hzjA
- active site: S131 (= S128), A132 (= A129), T133 (= T130), Y156 (= Y152), K160 (= K156)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), Y12 (≠ F15), I13 (= I16), D32 (= D35), N33 (= N36), H35 (≠ V38), N36 (= N39), D65 (= D62), I66 (≠ S63), F87 (= F84), A88 (= A85), G89 (≠ A86), K91 (= K88), S129 (= S126), S131 (= S128), Y156 (= Y152), K160 (= K156), Y184 (= Y180), P187 (= P183)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N182), N206 (= N202), L207 (= L203), N223 (≠ R219), V224 (= V220), F225 (= F221), R238 (= R234), Y240 (= Y236), V276 (= V272), R299 (= R295), D302 (= D298)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
58% identity, 98% coverage: 7:339/340 of query aligns to 4:343/347 of 1i3lA
- active site: S131 (= S128), A132 (= A129), T133 (= T130), Y156 (= Y152), K160 (= K156)
- binding galactose-uridine-5'-diphosphate: N186 (= N182), N206 (= N202), L207 (= L203), N223 (≠ R219), V224 (= V220), F225 (= F221), R238 (= R234), Y240 (= Y236), V276 (= V272), R299 (= R295), D302 (= D298)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), Y12 (≠ F15), I13 (= I16), D32 (= D35), N33 (= N36), H35 (≠ V38), N36 (= N39), D65 (= D62), I66 (≠ S63), F87 (= F84), A88 (= A85), G89 (≠ A86), K91 (= K88), S129 (= S126), S130 (= S127), S131 (= S128), Y156 (= Y152), K160 (= K156), Y184 (= Y180), P187 (= P183)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
58% identity, 98% coverage: 7:339/340 of query aligns to 4:343/347 of 1i3kA
- active site: S131 (= S128), A132 (= A129), T133 (= T130), Y156 (= Y152), K160 (= K156)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), Y12 (≠ F15), I13 (= I16), D32 (= D35), N33 (= N36), H35 (≠ V38), N36 (= N39), D65 (= D62), I66 (≠ S63), F87 (= F84), A88 (= A85), G89 (≠ A86), K91 (= K88), S129 (= S126), S131 (= S128), Y156 (= Y152), K160 (= K156), Y184 (= Y180), P187 (= P183)
- binding uridine-5'-diphosphate-glucose: F185 (= F181), N186 (= N182), N206 (= N202), L207 (= L203), N223 (≠ R219), V224 (= V220), F225 (= F221), R238 (= R234), Y240 (= Y236), V276 (= V272), R299 (= R295), D302 (= D298)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
58% identity, 98% coverage: 7:339/340 of query aligns to 5:344/348 of Q14376
- GYI 12:14 (≠ GFI 14:16) binding
- DNFHN 33:37 (≠ DNLVN 35:39) binding
- N34 (= N36) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ DS 62:63) binding
- F88 (= F84) binding
- G90 (≠ A86) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (= K88) binding
- V94 (= V90) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ E99) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S128) mutation to A: Loss of activity.
- SAT 132:134 (= SAT 128:130) binding
- Y157 (= Y152) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K156) binding
- A180 (≠ I175) to V: in dbSNP:rs3204468
- L183 (= L178) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y180) binding
- YFN 185:187 (= YFN 180:182) binding
- NNL 206:208 (= NNL 201:203) binding
- NVF 224:226 (≠ RVF 219:221) binding
- R239 (= R234) binding
- K257 (≠ A252) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RPGD 295:298) binding
- C307 (= C302) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ A308) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G314) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (= R330) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
58% identity, 98% coverage: 7:339/340 of query aligns to 5:344/346 of 1ek6A
- active site: S132 (= S128), A133 (= A129), T134 (= T130), Y157 (= Y152), K161 (= K156)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G11), G12 (= G14), Y13 (≠ F15), I14 (= I16), D33 (= D35), N34 (= N36), H36 (≠ V38), N37 (= N39), D66 (= D62), I67 (≠ S63), F88 (= F84), A89 (= A85), G90 (≠ A86), K92 (= K88), S130 (= S126), S131 (= S127), S132 (= S128), Y157 (= Y152), K161 (= K156), Y185 (= Y180), P188 (= P183)
- binding uridine-5'-diphosphate-glucose: S132 (= S128), Y157 (= Y152), F186 (= F181), N187 (= N182), N207 (= N202), L208 (= L203), N224 (≠ R219), V225 (= V220), F226 (= F221), R239 (= R234), Y241 (= Y236), V277 (= V272), R300 (= R295), D303 (= D298)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
61% identity, 99% coverage: 6:340/340 of query aligns to 3:343/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), Y12 (≠ F15), I13 (= I16), D32 (= D35), N33 (= N36), N36 (= N39), D62 (= D62), L63 (≠ S63), F84 (= F84), A85 (= A85), G86 (≠ A86), K88 (= K88), N103 (= N103), S126 (= S126), S128 (= S128), Y152 (= Y152), K156 (= K156), Y180 (= Y180), P183 (= P183)
- binding uridine-5'-diphosphate-glucose: S128 (= S128), A129 (= A129), F181 (= F181), N182 (= N182), N202 (= N202), L203 (= L203), T219 (≠ R219), V220 (= V220), Y221 (≠ F221), R234 (= R234), Y236 (= Y236), V275 (= V272), R298 (= R295), D301 (= D298)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
61% identity, 99% coverage: 6:340/340 of query aligns to 3:343/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), Y12 (≠ F15), I13 (= I16), D32 (= D35), N33 (= N36), N36 (= N39), D62 (= D62), L63 (≠ S63), F84 (= F84), A85 (= A85), G86 (≠ A86), K88 (= K88), N103 (= N103), S126 (= S126), S128 (= S128), Y152 (= Y152), K156 (= K156), Y180 (= Y180), P183 (= P183)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N182), N202 (= N202), L203 (= L203), T219 (≠ R219), Y221 (≠ F221), R234 (= R234), Y236 (= Y236), V275 (= V272), R298 (= R295), D301 (= D298)
Q564Q1 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Caenorhabditis elegans (see paper)
56% identity, 98% coverage: 7:340/340 of query aligns to 3:348/349 of Q564Q1
- P314 (= P306) mutation to L: In pv18; at the restrictive temperature of 25 degrees Celsius, embryos have cell-cell adhesion defects and die before hatching. The few surviving animals are arrested at the L1 larval stage. At the permissive temperature of 16-20 degrees Celsius, causes a developmental delay. Distal tip cell migration is impaired due to a reduced localization of metalloprotease mig-17 to the gonad basement membrane. Vulva lumen is smaller at the L4 larval stage. Accumulation of UDP-galactose (Gal) and reduction in UDP-N-acetylgalactosamine (GalNAc) levels. Hypersensitivity to a galactose-rich diet characterized by a slow development often resulting in an arrest at the L1 larval stage. Up-regulation of ER stress response protein hsp-4; expression is suppressed in an xbp-1 RNAi-mediated knockdown animals. Reduced survival upon E.faecalis or S.aureus-mediated infection.
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
55% identity, 98% coverage: 7:339/340 of query aligns to 3:336/338 of 2udpA
- active site: S124 (= S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156), M189 (≠ I192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), Y11 (≠ F15), I12 (= I16), D31 (= D35), N32 (= N36), L33 (= L37), C34 (≠ V38), N35 (= N39), S36 (= S40), D58 (= D62), I59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), S122 (= S126), S124 (= S128), Y149 (= Y152), K153 (= K156), Y177 (= Y180)
- binding phenyl-uridine-5'-diphosphate: N179 (= N182), N199 (= N202), L200 (= L203), A216 (≠ R219), I217 (≠ V220), F218 (= F221), R231 (= R234), Y233 (= Y236), V269 (= V272), R292 (= R295), D295 (= D298)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
55% identity, 98% coverage: 7:339/340 of query aligns to 3:336/338 of 1udcA
- active site: S124 (= S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156), M189 (≠ I192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), Y11 (≠ F15), I12 (= I16), D31 (= D35), N32 (= N36), C34 (≠ V38), N35 (= N39), S36 (= S40), D58 (= D62), I59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), S122 (= S126), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate-mannose: T126 (= T130), Y149 (= Y152), N179 (= N182), N199 (= N202), L200 (= L203), L215 (= L218), A216 (≠ R219), I217 (≠ V220), F218 (= F221), R231 (= R234), Y233 (= Y236), V269 (= V272), R292 (= R295)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
55% identity, 98% coverage: 7:339/340 of query aligns to 3:336/338 of P09147
- YI 11:12 (≠ FI 15:16) binding
- DNLCNS 31:36 (≠ DNLVNS 35:40) binding
- DI 58:59 (≠ DS 62:63) binding
- FAGLK 80:84 (≠ FAALK 84:88) binding
- N99 (= N103) binding
- S124 (= S128) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y152) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K156) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F181) binding
- Y299 (≠ C302) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
55% identity, 98% coverage: 7:339/340 of query aligns to 3:336/338 of 1udaA
- active site: S124 (= S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156), M189 (≠ I192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), Y11 (≠ F15), I12 (= I16), D31 (= D35), N32 (= N36), L33 (= L37), C34 (≠ V38), N35 (= N39), S36 (= S40), D58 (= D62), I59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), S122 (= S126), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (= T130), N179 (= N182), N199 (= N202), L200 (= L203), A216 (≠ R219), I217 (≠ V220), F218 (= F221), R231 (= R234), Y233 (= Y236), R292 (= R295), D295 (= D298), Y299 (≠ C302)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
55% identity, 98% coverage: 7:339/340 of query aligns to 3:336/338 of 1naiA
- active site: S124 (= S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156), M189 (≠ I192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), Y11 (≠ F15), I12 (= I16), D31 (= D35), N32 (= N36), L33 (= L37), C34 (≠ V38), N35 (= N39), S36 (= S40), D58 (= D62), I59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding 1,3-propandiol: N35 (= N39), K84 (= K88), E191 (= E194), P193 (= P196)
- binding uridine-5'-diphosphate: N179 (= N182), N199 (= N202), L200 (= L203), L215 (= L218), A216 (≠ R219), R231 (= R234), Y233 (= Y236), R292 (= R295)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
55% identity, 98% coverage: 7:339/340 of query aligns to 3:336/338 of 1lrjA
- active site: S124 (= S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156), M189 (≠ I192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), Y11 (≠ F15), I12 (= I16), D31 (= D35), N32 (= N36), L33 (= L37), C34 (≠ V38), N35 (= N39), S36 (= S40), D58 (= D62), I59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V90), S124 (= S128), F178 (= F181), N179 (= N182), L200 (= L203), L215 (= L218), A216 (≠ R219), F218 (= F221), R231 (= R234), Y233 (= Y236), V269 (= V272), R292 (= R295), D295 (= D298)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
55% identity, 98% coverage: 7:339/340 of query aligns to 3:336/338 of 1kvrA
- active site: A124 (≠ S128), A125 (= A129), T126 (= T130), Y149 (= Y152), K153 (= K156), M189 (≠ I192)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), Y11 (≠ F15), I12 (= I16), D31 (= D35), N32 (= N36), C34 (≠ V38), N35 (= N39), S36 (= S40), D58 (= D62), I59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), S122 (= S126), S123 (= S127), Y149 (= Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate: N179 (= N182), N198 (= N201), N199 (= N202), L200 (= L203), A216 (≠ R219), I217 (≠ V220), F218 (= F221), R231 (= R234), Y233 (= Y236), V269 (= V272), R292 (= R295), D295 (= D298)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
55% identity, 98% coverage: 7:339/340 of query aligns to 3:336/338 of 1a9yA
- active site: A124 (≠ S128), A125 (= A129), T126 (= T130), F149 (≠ Y152), K153 (= K156)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), Y11 (≠ F15), I12 (= I16), D31 (= D35), N32 (= N36), C34 (≠ V38), N35 (= N39), S36 (= S40), D58 (= D62), I59 (≠ S63), F80 (= F84), A81 (= A85), G82 (≠ A86), K84 (= K88), S122 (= S126), S123 (= S127), F149 (≠ Y152), K153 (= K156), Y177 (= Y180), P180 (= P183)
- binding uridine-5'-diphosphate-glucose: A125 (= A129), T126 (= T130), N179 (= N182), N199 (= N202), L200 (= L203), A216 (≠ R219), I217 (≠ V220), F218 (= F221), R231 (= R234), Y233 (= Y236), R292 (= R295), D295 (= D298), Y299 (≠ C302)
Query Sequence
>BPHYT_RS07405 FitnessBrowser__BFirm:BPHYT_RS07405
MDLKGTILVTGGAGFIGSHTCVELLNGGYDVVVVDNLVNSNRESLKRVEQITGKRVAFHE
TDSRDESALQRIFDAHPVSGAIHFAALKAVGESVSKPIEYYDNNLGSLLTLLSVMRARDV
KQFVFSSSATVYGVPKTSPIDESFPLSATNPYGQTKLIAEQILRDLEVSDPSWRIATLRY
FNPVGAHESGLIGEDPGGVPNNLMPYVAQVAVGKLEKLRVFGGDYDTPDGTGVRDYIHVV
DLARGHLAALDALVARDASFVVNLGTGQGYSVLDVVRSFEKASGKPVPYEIVARRPGDVA
SCFADPAAAEKLLGWRAQYGIERMCADHWRWQSTNPAGYA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory