Comparing BPHYT_RS07500 FitnessBrowser__BFirm:BPHYT_RS07500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 96% coverage: 17:389/390 of query aligns to 10:376/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 97% coverage: 12:389/390 of query aligns to 47:427/442 of P54968
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 96% coverage: 15:389/390 of query aligns to 46:423/440 of O04373
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
38% identity, 83% coverage: 16:340/390 of query aligns to 18:344/398 of 6slfA
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 97% coverage: 1:378/390 of query aligns to 1:377/389 of 4ewtA
3ramA Crystal structure of hmra (see paper)
26% identity, 68% coverage: 18:283/390 of query aligns to 19:265/391 of 3ramA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
25% identity, 46% coverage: 96:275/390 of query aligns to 92:272/377 of 7t1qA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
22% identity, 77% coverage: 17:315/390 of query aligns to 2:306/373 of 3rzaA
Sites not aligning to the query:
>BPHYT_RS07500 FitnessBrowser__BFirm:BPHYT_RS07500
MNTMAIPAGIAELEDEMIALRRQIHAHPELAYEEFATGDLVAERLQEWGYTVHRGLGQTG
VVGQLKVGNGTRKLGLRADMDALPIHETTGLPYASKLPGKMHACGHDGHTAMLLAAAKHL
AQEKCFDGTLNLIFQPAEEGLAGAKKMLEDGLFDKFPCDAVFAMHNMPGYPAGKFGFLPG
SFMASSDTVIIKVTGRGGHGAVPHKAVDPVVVCAQIVLALQSIVSRNIAPLDMAIITVGA
IHAGEAPNVIPETAEMRLSVRALKPEVRDYLQERITAVACGQAAVFGARADVDYQRRYPV
LVNDPAMTGLARQVALDWLGDDGLIADMQPLTGSEDFAFLLERCAGSYLIIGNGDGEGGC
MVHNPGYDFNDDCLATGAAYWVRLAQTFLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory