Comparing BPHYT_RS07580 FitnessBrowser__BFirm:BPHYT_RS07580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
51% identity, 98% coverage: 11:467/468 of query aligns to 3:452/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
51% identity, 98% coverage: 11:467/468 of query aligns to 2:451/451 of 4rdvB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
51% identity, 97% coverage: 11:466/468 of query aligns to 2:450/450 of 3mduA
4f0lB Crystal structure of amidohydrolase from brucella melitensis
44% identity, 98% coverage: 8:467/468 of query aligns to 1:448/449 of 4f0lB
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
25% identity, 87% coverage: 42:446/468 of query aligns to 47:416/441 of 3lnpA
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
25% identity, 80% coverage: 58:431/468 of query aligns to 58:412/452 of 8is4A
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
22% identity, 84% coverage: 58:448/468 of query aligns to 58:436/474 of 4v1xE
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
22% identity, 84% coverage: 58:448/468 of query aligns to 58:436/474 of P72156
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
27% identity, 53% coverage: 213:460/468 of query aligns to 182:427/435 of 4gbdA
Sites not aligning to the query:
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
27% identity, 53% coverage: 213:460/468 of query aligns to 182:427/437 of 4dykA
Sites not aligning to the query:
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
24% identity, 90% coverage: 33:455/468 of query aligns to 32:423/439 of 4dzhA
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
27% identity, 80% coverage: 58:431/468 of query aligns to 57:388/428 of 3hpaA
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
21% identity, 84% coverage: 58:448/468 of query aligns to 58:436/474 of Q9EYU0
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
22% identity, 74% coverage: 58:405/468 of query aligns to 58:372/434 of 4f0sA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
22% identity, 74% coverage: 58:405/468 of query aligns to 58:372/436 of 4f0rA
2oodA Crystal structure of guanine deaminase from bradyrhizobium japonicum
23% identity, 52% coverage: 170:413/468 of query aligns to 158:416/463 of 2oodA
Sites not aligning to the query:
>BPHYT_RS07580 FitnessBrowser__BFirm:BPHYT_RS07580
MTEPHKQSNQSLFAEYAYLRDGWRRNVLLEWDTNGTLTAVTPDTSTPPIGVQKAAGPILP
GMPNLHSHAFQRAMAGLTEYRASGAGATDNFWSWRDLMYRFAARITPEGLASVAQWLYIE
MLKAGYTSVCEFHYVHHTPDGSRYANQAELAQRVVDAASASGIGMTMLPVLYQYSGFGSR
APREDQQRFINTPESLLDLLGTLRAARPETAALRYGVAPHSLRAVSAESLRTLLGGIDNT
APVHIHIAEQTAEVDACVETEGARPVQWLLDRFDIDSRWCLVHATHVDANETLALAKSGA
VAGLCLTTEANLGDGIFPAQEYLDAQGRIGVGSDSHIGVDWRAELRLLEYGQRLARRQRN
VLASAQATHVADRLFAASLEGGAHATGRAVGALQTGRRADWLVLDANHSSIAEHAPNAWL
SGVVFCEHGETPIRDVYAGGDKVVDNRRHRDEEGAYARYRMALADLLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory