Comparing BPHYT_RS07695 FitnessBrowser__BFirm:BPHYT_RS07695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
61% identity, 97% coverage: 6:402/411 of query aligns to 3:399/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
61% identity, 97% coverage: 6:402/411 of query aligns to 3:399/401 of 4adbB
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
58% identity, 97% coverage: 6:402/411 of query aligns to 3:399/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
58% identity, 97% coverage: 6:402/411 of query aligns to 8:404/405 of P40732
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
57% identity, 97% coverage: 6:402/411 of query aligns to 3:394/397 of 4jewA
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
57% identity, 96% coverage: 10:402/411 of query aligns to 1:388/389 of 2pb0A
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
41% identity, 93% coverage: 21:401/411 of query aligns to 11:385/385 of Q9X2A5
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
41% identity, 93% coverage: 21:401/411 of query aligns to 19:393/393 of 2ordA
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 97% coverage: 5:401/411 of query aligns to 56:456/457 of Q9M8M7
Sites not aligning to the query:
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
42% identity, 92% coverage: 21:398/411 of query aligns to 12:376/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
42% identity, 92% coverage: 21:398/411 of query aligns to 11:375/375 of 2eh6A
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
40% identity, 95% coverage: 7:398/411 of query aligns to 2:389/390 of 8ht4B
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
38% identity, 94% coverage: 15:400/411 of query aligns to 4:387/388 of 3nx3A
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
40% identity, 97% coverage: 8:404/411 of query aligns to 12:399/400 of P9WPZ7
Sites not aligning to the query:
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
40% identity, 91% coverage: 28:402/411 of query aligns to 33:394/395 of Q5SHH5
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
41% identity, 91% coverage: 8:382/411 of query aligns to 6:371/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
41% identity, 91% coverage: 8:382/411 of query aligns to 6:371/391 of 7nn4A
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 91% coverage: 28:402/411 of query aligns to 25:386/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 91% coverage: 28:402/411 of query aligns to 25:386/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 91% coverage: 28:402/411 of query aligns to 25:386/387 of 1vefA
Sites not aligning to the query:
>BPHYT_RS07695 FitnessBrowser__BFirm:BPHYT_RS07695
MNDLTVTRQTFDEVMVPVFSPAAFVPDRGLGSRVWDTQGRDYIDFAGGIAVTALGHAHPE
LLNVLHEQGGKLWHIGNGYTNEPVLRLAKRLEDLTFADRAFFANSGAEANEAALKLARRV
AFDRHGADKYEIISFTQSFHGRTFFTVSVGGQPKYSEGFGPVPAGITHLPYNDIEAVKKA
IGAQTCAVIVEPIQGEGGVIPADPAFLKALREACDQHGALLIFDEVQTGVGRSGYFYAYQ
ETGVTPDILTTAKALGNGFPIGAMLTTNELAAYFKVGVHGTTYGGNPLGAAIAEKVVELV
SDPKLLEGVRSRSEALKGHLAKLNERFGLFTEVRGRGLLIGAELNEAFKGRAKDFVTAAG
QHGVIMLMAGPDVLRFVPSLIMPLDDMNEGFERLAKAIESIVGAKAEAASN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory