SitesBLAST
Comparing BPHYT_RS07710 FitnessBrowser__BFirm:BPHYT_RS07710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
63% identity, 99% coverage: 4:487/487 of query aligns to 6:488/488 of 5u0mA
- active site: N148 (= N146), K171 (= K169), E246 (= E244), C280 (= C278), E377 (= E376), P455 (= P454)
- binding nicotinamide-adenine-dinucleotide: F144 (= F142), Y147 (= Y145), N148 (= N146), K171 (= K169), S173 (= S171), E174 (= E172), G207 (= G205), T222 (= T220), G223 (= G221), S224 (= S222), V227 (≠ T225), E246 (= E244), M247 (= M245), G248 (= G246), C280 (= C278), E377 (= E376), F379 (= F378)
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
63% identity, 99% coverage: 4:487/487 of query aligns to 6:488/488 of 5u0lA
- active site: N148 (= N146), K171 (= K169), E246 (= E244), C280 (= C278), E377 (= E376), P455 (= P454)
- binding decanal: K107 (= K105), H152 (= H150), L153 (= L151), G156 (= G154), H157 (= H155), S456 (= S455), A457 (= A456)
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
60% identity, 100% coverage: 1:485/487 of query aligns to 2:486/486 of 3ju8A
- active site: N147 (= N146), K170 (= K169), E245 (= E244), C279 (= C278), E377 (= E376), P455 (= P454)
- binding nicotinamide-adenine-dinucleotide: G144 (= G143), Y146 (= Y145), N147 (= N146), L152 (= L151), K170 (= K169), S172 (= S171), F220 (= F219), T221 (= T220), G222 (= G221), S223 (= S222), T226 (= T225), E245 (= E244), M246 (= M245), G247 (= G246), C279 (= C278), E377 (= E376), F379 (= F378), F444 (= F443)
O94788 Retinal dehydrogenase 2; RALDH 2; RalDH2; Aldehyde dehydrogenase family 1 member A2; ALDH1A2; Retinaldehyde-specific dehydrogenase type 2; RALDH(II); EC 1.2.1.36 from Homo sapiens (Human) (see 6 papers)
32% identity, 93% coverage: 2:453/487 of query aligns to 38:493/518 of O94788
- E50 (≠ G13) to G: in dbSNP:rs34266719
- A110 (= A70) to V: in dbSNP:rs35365164
- Q182 (≠ V141) to K: in DIH4; decreased retinoic acid biosynthetic process
- IPW 184:186 (≠ GPY 143:145) binding
- KPAE 210:213 (≠ KPSE 169:172) binding
- STE 264:266 (≠ SSD 222:224) binding
- C320 (= C278) active site, Nucleophile
- R347 (≠ I306) to H: in DIH4; decreased expression; dbSNP:rs141245344
- V348 (≠ T307) to I: in dbSNP:rs4646626
- KQYNK 366:370 (≠ RAASR 326:330) binding
- A383 (= A343) to T: in DIH4; uncertain significance; dbSNP:rs749124508
- E417 (= E376) binding
- E436 (= E395) to K: in dbSNP:rs34744827
- S461 (≠ Q420) to Y: in DIH4; decreased retinoic acid biosynthetic process
6b5hA Aldh1a2 liganded with NAD and 1-(4-cyanophenyl)-n-(3-fluorophenyl)-3- [4-(methylsulfonyl)phenyl]-1h-pyrazole-4-carboxamide (compound cm121) (see paper)
32% identity, 93% coverage: 2:453/487 of query aligns to 12:467/492 of 6b5hA
- active site: N161 (= N146), E260 (= E244), C294 (= C278)
- binding 1-(4-cyanophenyl)-N-(3-fluorophenyl)-3-[4-(methylsulfonyl)phenyl]-1H-pyrazole-4-carboxamide: V112 (≠ A104), G116 (≠ I108), F162 (= F147), W169 (≠ G154), Q284 (= Q268), F288 (≠ L272), T295 (= T279), N449 (= N435), L451 (≠ A437), N452 (≠ S438), F457 (= F443)
- binding nicotinamide-adenine-dinucleotide: I157 (≠ F142), I158 (≠ G143), W160 (≠ Y145), N161 (= N146), K184 (= K169), G217 (≠ K202), G221 (= G205), F235 (= F219), T236 (= T220), G237 (= G221), S238 (= S222), V241 (≠ T225), E260 (= E244), L261 (≠ M245), C294 (= C278), F393 (= F378)
Sites not aligning to the query:
6b5gA Aldh1a2 liganded with NAD and (3-ethoxythiophen-2-yl){4-[4-nitro-3- (pyrrolidin-1-yl)phenyl]piperazin-1-yl}methanone (compound 6-118) (see paper)
32% identity, 93% coverage: 2:453/487 of query aligns to 12:467/492 of 6b5gA
- active site: N161 (= N146), E260 (= E244), C294 (= C278)
- binding (3-ethoxythiophen-2-yl){4-[4-nitro-3-(pyrrolidin-1-yl)phenyl]piperazin-1-yl}methanone: F162 (= F147), L165 (≠ H150), W169 (≠ G154), F288 (≠ L272), C293 (≠ R277), C294 (= C278), T295 (= T279), N449 (= N435), L451 (≠ A437)
- binding nicotinamide-adenine-dinucleotide: I157 (≠ F142), I158 (≠ G143), P159 (= P144), W160 (≠ Y145), N161 (= N146), M166 (≠ L151), K184 (= K169), E187 (= E172), G217 (≠ K202), G221 (= G205), F235 (= F219), T236 (= T220), G237 (= G221), S238 (= S222), V241 (≠ T225), E260 (= E244), L261 (≠ M245), C294 (= C278), E391 (= E376), F393 (= F378)
Sites not aligning to the query:
6aljA Aldh1a2 liganded with NAD and compound win18,446 (see paper)
32% identity, 93% coverage: 2:453/487 of query aligns to 12:467/492 of 6aljA
- active site: N161 (= N146), E260 (= E244), C294 (= C278)
- binding N,N'-(octane-1,8-diyl)bis(2,2-dichloroacetamide): G116 (≠ I108), F162 (= F147), L165 (≠ H150), M166 (≠ L151), W169 (≠ G154), E260 (= E244), C293 (≠ R277), C294 (= C278), L451 (≠ A437), N452 (≠ S438), A453 (≠ S439)
- binding nicotinamide-adenine-dinucleotide: I157 (≠ F142), I158 (≠ G143), P159 (= P144), W160 (≠ Y145), N161 (= N146), K184 (= K169), E187 (= E172), G217 (≠ K202), G221 (= G205), F235 (= F219), G237 (= G221), S238 (= S222), V241 (≠ T225), Q341 (≠ A327), K344 (≠ R330), E391 (= E376), F393 (= F378)
Sites not aligning to the query:
Q63639 Retinal dehydrogenase 2; RALDH 2; RalDH2; Aldehyde dehydrogenase family 1 member A2; ALDH1A2; Retinaldehyde-specific dehydrogenase type 2; RALDH(II); EC 1.2.1.36 from Rattus norvegicus (Rat) (see paper)
32% identity, 93% coverage: 2:453/487 of query aligns to 38:493/518 of Q63639
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 5:462/487 of query aligns to 14:472/482 of P25526
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
33% identity, 94% coverage: 5:462/487 of query aligns to 13:471/481 of 3jz4A
- active site: N156 (= N146), K179 (= K169), E254 (= E244), C288 (= C278), E385 (= E376), E462 (≠ P454)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P144), W155 (≠ Y145), K179 (= K169), A181 (≠ S171), S182 (≠ E172), A212 (≠ K202), G216 (= G205), G232 (= G221), S233 (= S222), I236 (≠ T225), C288 (= C278), K338 (≠ R330), E385 (= E376), F387 (= F378)
5izdA Wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with NADP
31% identity, 90% coverage: 2:440/487 of query aligns to 3:445/494 of 5izdA
- active site: N149 (= N146), K172 (= K169), E247 (= E244), C281 (= C278), E381 (= E376)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L145 (≠ F142), T146 (≠ G143), W148 (≠ Y145), K172 (= K169), P173 (= P170), S174 (= S171), S175 (≠ E172), R204 (≠ E201), G205 (vs. gap), G209 (= G205), D210 (≠ I206), G225 (= G221), S226 (= S222), T229 (= T225)
Sites not aligning to the query:
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
32% identity, 98% coverage: 1:477/487 of query aligns to 5:481/489 of 6wsbA
- active site: N152 (= N146), E250 (= E244), C284 (= C278), E462 (≠ P454)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ F142), G149 (= G143), A150 (≠ P144), W151 (≠ Y145), N152 (= N146), K175 (= K169), E178 (= E172), G208 (≠ K202), G211 (= G205), A212 (≠ I206), F225 (= F219), T226 (= T220), G227 (= G221), G228 (≠ S222), T231 (= T225), V235 (≠ L229), E250 (= E244), L251 (≠ M245), G252 (= G246), C284 (= C278), E385 (= E376), F387 (= F378)
4pz2B Structure of zm aldh2-6 (rf2f) in complex with NAD (see paper)
32% identity, 95% coverage: 1:461/487 of query aligns to 10:476/494 of 4pz2B
- active site: N159 (= N146), K182 (= K169), E258 (= E244), C292 (= C278), E392 (= E376), D469 (≠ P454)
- binding nicotinamide-adenine-dinucleotide: I155 (≠ F142), I156 (≠ G143), P157 (= P144), W158 (≠ Y145), N159 (= N146), M164 (≠ L151), K182 (= K169), A184 (≠ S171), E185 (= E172), G215 (≠ K202), G219 (= G205), F233 (= F219), T234 (= T220), G235 (= G221), S236 (= S222), V239 (≠ T225), E258 (= E244), L259 (≠ M245), C292 (= C278), E392 (= E376), F394 (= F378)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
32% identity, 96% coverage: 3:471/487 of query aligns to 8:482/490 of Q9HTJ1
- GAWN 150:153 (≠ GPYN 143:146) binding
- K162 (≠ H155) active site, Charge relay system
- KPSE 176:179 (= KPSE 169:172) binding
- G209 (vs. gap) binding
- GTST 230:233 (≠ SSDT 222:225) binding
- E252 (= E244) active site, Proton acceptor
- C286 (= C278) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E376) binding
- E464 (≠ P454) active site, Charge relay system
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
32% identity, 96% coverage: 3:471/487 of query aligns to 7:481/489 of 4cazA
- active site: N152 (= N146), K175 (= K169), E251 (= E244), C285 (= C278), E386 (= E376), E463 (≠ P454)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (≠ F142), G149 (= G143), W151 (≠ Y145), N152 (= N146), K175 (= K169), E178 (= E172), G208 (vs. gap), G212 (= G205), F226 (= F219), T227 (= T220), G228 (= G221), G229 (≠ S222), T232 (= T225), V236 (≠ L229), E251 (= E244), L252 (≠ M245), C285 (= C278), E386 (= E376), F388 (= F378)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
32% identity, 96% coverage: 3:471/487 of query aligns to 7:481/489 of 2woxA
- active site: N152 (= N146), K175 (= K169), E251 (= E244), C285 (= C278), E386 (= E376), E463 (≠ P454)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (≠ F142), G149 (= G143), W151 (≠ Y145), N152 (= N146), K175 (= K169), S177 (= S171), E178 (= E172), G208 (vs. gap), G212 (= G205), F226 (= F219), T227 (= T220), G228 (= G221), G229 (≠ S222), T232 (= T225), V236 (≠ L229), E251 (= E244), L252 (≠ M245), C285 (= C278), E386 (= E376), F388 (= F378)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
32% identity, 96% coverage: 3:471/487 of query aligns to 7:481/489 of 2wmeA
- active site: N152 (= N146), K175 (= K169), E251 (= E244), C285 (= C278), E386 (= E376), E463 (≠ P454)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (= G143), W151 (≠ Y145), K175 (= K169), S177 (= S171), E178 (= E172), G208 (vs. gap), G212 (= G205), F226 (= F219), G228 (= G221), G229 (≠ S222), T232 (= T225), V236 (≠ L229)
P47895 Retinaldehyde dehydrogenase 3; RALDH-3; RalDH3; Aldehyde dehydrogenase 6; Aldehyde dehydrogenase family 1 member A3; ALDH1A3; EC 1.2.1.36 from Homo sapiens (Human) (see 2 papers)
30% identity, 97% coverage: 1:471/487 of query aligns to 31:506/512 of P47895
- R89 (≠ S55) to C: in MCOP8; does not affect ALDH1A3 expression; results in strongly reduced protein levels; dbSNP:rs397514652
- K204 (= K169) binding
- E207 (= E172) binding
- GSTEVG 257:262 (≠ GSSDTG 221:226) binding
- Q361 (≠ A327) binding
- E411 (= E376) binding
- A493 (= A459) to P: in MCOP8; does not affect ALDH1A3 expression; results in strongly reduced protein levels; dbSNP:rs397514653
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
7a6qB Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
30% identity, 97% coverage: 1:471/487 of query aligns to 13:488/489 of 7a6qB
- active site: N163 (= N146), E262 (= E244), C296 (= C278), E470 (≠ P454)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ F142), W162 (≠ Y145), K186 (= K169), E189 (= E172), G219 (≠ K202), G223 (= G205), S240 (= S222), V243 (≠ T225), K342 (≠ R326)
- binding (3-oxidanylidene-3-sodiooxy-propanoyl)oxysodium: A32 (= A19), T33 (≠ S20), C34 (≠ H21), P36 (= P23), D103 (≠ E87), E189 (= E172), Q190 (≠ L173), F218 (≠ E201), I339 (= I323), D340 (≠ S324)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ M102), D141 (≠ A125), N143 (≠ G127), N451 (= N435), L453 (≠ A437), A455 (≠ S439)
7a6qA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
30% identity, 97% coverage: 1:471/487 of query aligns to 13:488/489 of 7a6qA
- active site: N163 (= N146), E262 (= E244), C296 (= C278), E470 (≠ P454)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ F142), T160 (≠ G143), W162 (≠ Y145), K186 (= K169), A188 (≠ S171), E189 (= E172), G219 (≠ K202), G223 (= G205), S240 (= S222), V243 (≠ T225), K342 (≠ R326), K346 (≠ R330)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ M102), D141 (≠ A125), N143 (≠ G127), N451 (= N435), L453 (≠ A437), Y454 (≠ S438)
Query Sequence
>BPHYT_RS07710 FitnessBrowser__BFirm:BPHYT_RS07710
MSELFIDGEWAAGTGPAFASHNPGTGAAVWEGNSASADDVDRAVRSARRAFPAWSALSLD
ERCGVVRRFAALVTERKEALAEAIGRETGKPLWEARTEAASMAAKVEISIQAYNERTGEK
RSAMADGTAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNAVVFKPSELAPGVAAL
TVQIWRDAGLPTGVLNLVQGEKDTGIALANHRQIDGLFFTGSSDTGTLLHKQFGGRPEIV
LALEMGGNNPLVIGPVADVDAAVHHTIQSAFLSAGQRCTCARRIFVPNDAGGDRFMERFT
EVTSRITVGEYNADPQPFMGAVISARAASRLVAAQERLLADGAKALLKMEQRDPKLGFVT
PAILDVTNVKNLPDEEHFGPLAQIIRYGSFNEALEQANDTEFGLSAGLLADDEALWTHFQ
RTIRAGIVNWNRPTNGASSGAPFGGPGRSGNHRPSAYYAADYCAFPMASVESAQLQMPAS
VSPGLQF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory