Comparing BPHYT_RS07850 FitnessBrowser__BFirm:BPHYT_RS07850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
82% identity, 100% coverage: 2:311/311 of query aligns to 1:310/310 of 5umhB
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
81% identity, 100% coverage: 1:310/311 of query aligns to 5:312/312 of 5vxtB
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
78% identity, 99% coverage: 3:309/311 of query aligns to 1:307/307 of 5td3A
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
56% identity, 99% coverage: 1:309/311 of query aligns to 1:311/311 of P07773
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
56% identity, 99% coverage: 3:309/311 of query aligns to 1:309/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
56% identity, 99% coverage: 3:309/311 of query aligns to 1:309/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
56% identity, 99% coverage: 3:309/311 of query aligns to 1:309/309 of 1dlmA
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
48% identity, 98% coverage: 3:307/311 of query aligns to 1:305/309 of 2azqA
2xsrA Crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase (see paper)
52% identity, 95% coverage: 13:308/311 of query aligns to 10:308/309 of 2xsrA
3th1A Crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida
38% identity, 77% coverage: 29:267/311 of query aligns to 4:232/246 of 3th1A
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 11:236/258 of 3hgiA
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 9:234/256 of 3i51A
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 9:234/256 of 3i4yA
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 9:234/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 9:234/256 of 3hjsA
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 9:234/256 of 3hjqA
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 9:234/256 of 3hhyA
3hhxA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 9:234/256 of 3hhxA
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
34% identity, 75% coverage: 29:262/311 of query aligns to 10:235/257 of 3hj8A
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
32% identity, 73% coverage: 35:262/311 of query aligns to 2:231/256 of 3o6rA
>BPHYT_RS07850 FitnessBrowser__BFirm:BPHYT_RS07850
MSVKVFDTKEVQDLLKAAANVGSQDGGARAKQIVNRLLGDLFKAIDDLDMTPDEIWAGVH
YFNKLGQDGEAALLAAGLGLEKYLDIRMDAEDKAAEITGGTPRTIEGPLYVAGAPVREGV
SRIDIDPDEDAGPLVIRGTVTGPDGKPVAGALVECWHANSKGFYSHFDPTSKQSEFNLRG
AVSTGADGKYEFRTLMPVGYGCPPHGATQQLLDVLGRHGNRPAHVHFFVTADKSRKLTTQ
INIEGDPLIWDDFAYATREDLIPHVVEKTGGTALGMKTDAYKEIQFDIELTPLIQGKDNQ
LVHRPRVSVSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory