Comparing BPHYT_RS08740 FitnessBrowser__BFirm:BPHYT_RS08740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
26% identity, 70% coverage: 77:377/427 of query aligns to 66:348/403 of P77589
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
28% identity, 40% coverage: 34:202/427 of query aligns to 56:206/444 of Q8NLB7
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
22% identity, 72% coverage: 82:388/427 of query aligns to 63:394/446 of A0A0H2VG78
Sites not aligning to the query:
>BPHYT_RS08740 FitnessBrowser__BFirm:BPHYT_RS08740
MSTSTLQASAARPSAAKVHRIILAASIGNALEWFDLVVYGFFAVTIAKLFFPARTEAISL
MLTLGTFGISYMIRPLGGLVLGSLADRAGRKASLLLSIALMMVGTLTIAVMPPYAAIGLW
APAGIMLSRLVQGFSAGGEFGASTAFLVEHAPERRGFMGSWQFASQGMATLLASGFGALL
TSQLTSAQLESWGWRVPFLFGLAIGPVGFYIRRYVDEGAEFNAEPKARTPLRDLFGTQKV
RMLLAVGSLIISTAANYMILYMPTYAIKQLHLPASTGFAATLATGVVLTVLTPFAGHLSD
RLGRIRIMATAAVLMLVTVYPAFVYMNAHPSFVTMLLALIWIGVLKATYFGALPALMSEI
FPTQTRATGLAVSYNIGVTVFGGFAPFVITWLIDASGNKLAPGFYLMFCAVASLLALYAV
RGRLKIR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory