SitesBLAST
Comparing BPHYT_RS09175 FitnessBrowser__BFirm:BPHYT_RS09175 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
31% identity, 96% coverage: 11:310/312 of query aligns to 2:305/308 of 2dcnA
- active site: G252 (= G257), A253 (= A258), G254 (= G259), D255 (= D260)
- binding adenosine-5'-diphosphate: D193 (≠ S197), K223 (= K228), G225 (= G230), P226 (≠ K231), G228 (= G233), V247 (≠ A252), G254 (= G259), I279 (≠ N284), S282 (≠ A287), V286 (≠ T291)
- binding 6-O-phosphono-beta-D-psicofuranosonic acid: G33 (= G38), F89 (≠ Y94), Y105 (= Y107), R107 (= R109), I136 (= I138), R165 (= R171), T251 (= T256), G252 (= G257), D255 (= D260), D291 (≠ A296)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
33% identity, 85% coverage: 11:275/312 of query aligns to 3:273/313 of Q97U29
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
33% identity, 85% coverage: 11:275/312 of query aligns to 2:272/311 of 2varA
- active site: G254 (= G257), A255 (= A258), G256 (= G259), D257 (= D260)
- binding adenosine monophosphate: G227 (= G230), G230 (= G233), M259 (≠ F262)
- binding phosphoaminophosphonic acid-adenylate ester: K225 (= K228), G227 (= G230), S228 (≠ K231), G230 (= G233), G254 (= G257), A255 (= A258), G256 (= G259), D257 (= D260), M259 (≠ F262)
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: L10 (≠ M19), G33 (= G38), S34 (≠ D39), Y89 (= Y94), Y105 (= Y107), R107 (= R109), I136 (= I138), R165 (= R171), G254 (= G257), D257 (= D260)
- binding 2-keto-3-deoxygluconate: G33 (= G38), S34 (≠ D39), Y89 (= Y94), L103 (≠ F105), Y105 (= Y107), R107 (= R109), I136 (= I138), R165 (= R171), T253 (= T256), G254 (= G257), D257 (= D260)
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
30% identity, 90% coverage: 29:310/312 of query aligns to 19:305/306 of 5eynA
- active site: G246 (= G257), A247 (= A258), G248 (= G259), D249 (= D260)
- binding adenosine-5'-diphosphate: H91 (≠ N101), T217 (≠ K228), G219 (= G230), A220 (≠ K231), A238 (≠ V249), V239 (= V250), T244 (≠ A255), G246 (= G257), A247 (= A258), G248 (= G259), F251 (= F262), N279 (= N284), G282 (≠ A287), A283 (= A288)
- binding beryllium trifluoride ion: G246 (= G257), G248 (= G259), D249 (= D260)
- binding beta-D-fructofuranose: G28 (= G38), A29 (≠ D39), N32 (= N42), F96 (= F105), F98 (≠ Y107), R159 (= R171), D249 (= D260)
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
30% identity, 90% coverage: 29:310/312 of query aligns to 23:309/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (≠ L195), T221 (≠ K228), G223 (= G230), A242 (≠ V249), V243 (= V250), F255 (= F262), N283 (= N284), G286 (≠ A287), A287 (= A288)
- binding beta-D-fructofuranose: G32 (= G38), A33 (≠ D39), F100 (= F105), F102 (≠ Y107), R163 (= R171), D253 (= D260)
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
29% identity, 96% coverage: 11:310/312 of query aligns to 3:305/308 of 3iq0B
- active site: G252 (= G257), A253 (= A258), G254 (= G259), D255 (= D260)
- binding adenosine-5'-triphosphate: S192 (= S197), K223 (= K228), G225 (= G230), E247 (≠ A252), A253 (= A258), G254 (= G259), F257 (= F262), N279 (= N284), G282 (≠ A287)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 96% coverage: 11:310/312 of query aligns to 3:301/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
31% identity, 96% coverage: 11:310/312 of query aligns to 3:301/301 of 1v1aA
- active site: G248 (= G257), A249 (= A258), G250 (= G259), D251 (= D260)
- binding adenosine-5'-diphosphate: K219 (= K228), G221 (= G230), A222 (≠ K231), A249 (= A258), G250 (= G259), N275 (= N284), A279 (= A288)
- binding 2-keto-3-deoxygluconate: L11 (≠ M19), G34 (= G38), A35 (≠ D39), N38 (= N42), Y89 (= Y94), R105 (= R109), R167 (= R171), G248 (= G257), D251 (= D260), D287 (≠ A296)
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
31% identity, 96% coverage: 11:309/312 of query aligns to 3:300/300 of 1v1bA
- active site: G248 (= G257), A249 (= A258), G250 (= G259), D251 (= D260)
- binding adenosine-5'-triphosphate: K219 (= K228), G221 (= G230), A238 (≠ G247), F239 (≠ H248), V241 (= V250), G248 (= G257), A249 (= A258), G250 (= G259), N275 (= N284), A279 (= A288)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 93% coverage: 11:301/312 of query aligns to 6:298/319 of Q8ZKR2
- D16 (≠ E21) binding
- G31 (= G38) binding
- Y101 (= Y107) binding
- R162 (= R171) binding
- A180 (≠ V183) binding
- A181 (≠ M184) binding
- A183 (≠ E186) binding
- G213 (= G221) binding
- D246 (= D254) binding
- T248 (= T256) binding
- D252 (= D260) binding
- A287 (≠ S290) binding
- A290 (≠ G293) binding
- G292 (= G295) binding
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
28% identity, 93% coverage: 11:301/312 of query aligns to 2:287/297 of 1tz6A
- active site: C24 (≠ G35), F88 (= F105), G238 (= G257), A239 (= A258), G240 (= G259), D241 (= D260)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N169), K176 (≠ L195), E181 (≠ D200), S209 (≠ K228), G211 (= G230), A212 (≠ K231), G214 (= G233), A239 (= A258), G240 (= G259), F243 (= F262), N270 (= N284), G273 (≠ A287), A274 (= A288)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E17), D12 (≠ E21), G27 (= G38), F88 (= F105), Y90 (= Y107), R151 (= R171), M154 (≠ L174), D241 (= D260)
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
28% identity, 93% coverage: 11:301/312 of query aligns to 2:287/299 of 1tz3A
- active site: C24 (≠ G35), F88 (= F105), G238 (= G257), A239 (= A258), G240 (= G259), D241 (= D260)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E17), S10 (≠ M19), D12 (≠ E21), G27 (= G38), L83 (≠ Y94), F88 (= F105), Y90 (= Y107), R151 (= R171), M154 (≠ L174), D241 (= D260)
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
29% identity, 88% coverage: 37:310/312 of query aligns to 39:308/312 of 3in1A
- active site: R106 (vs. gap), G255 (= G257), A256 (= A258), G257 (= G259), D258 (= D260)
- binding adenosine-5'-diphosphate: N194 (≠ S197), K225 (= K228), G227 (= G230), G230 (= G233), A244 (≠ G247), T253 (≠ A255), N282 (= N284), A285 (= A287)
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
30% identity, 91% coverage: 12:296/312 of query aligns to 2:283/302 of 3gbuA
- active site: G242 (= G257), A243 (= A258), G244 (= G259), D245 (= D260)
- binding adenosine-5'-triphosphate: K188 (≠ L195), T213 (≠ K228), G215 (= G230), V235 (= V250), P237 (≠ A252), A243 (= A258), G244 (= G259), A274 (= A287)
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
30% identity, 91% coverage: 12:296/312 of query aligns to 3:284/304 of 3ih0A
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
30% identity, 90% coverage: 31:311/312 of query aligns to 32:303/306 of 4xckA
- active site: A249 (≠ G257), A250 (= A258), G251 (= G259), D252 (= D260)
- binding adenosine-5'-diphosphate: T220 (≠ K228), G222 (= G230), S223 (≠ K231), V242 (= V250), T247 (≠ A255), A250 (= A258), F254 (= F262), H276 (≠ N284), A279 (= A287), V283 (≠ T291)
- binding alpha-D-ribofuranose: G39 (= G38), K40 (≠ D39), N43 (= N42), A95 (≠ Y94), I107 (≠ D106), I109 (≠ L108), E140 (≠ A141), T248 (= T256), D252 (= D260)
Sites not aligning to the query:
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
33% identity, 93% coverage: 12:300/312 of query aligns to 17:306/306 of 4ebuA
- active site: A263 (≠ G257), A264 (= A258), G265 (= G259), D266 (= D260)
- binding adenosine-5'-diphosphate: S202 (= S197), K233 (= K228), G235 (= G230), V255 (= V249), A264 (= A258), G265 (= G259), F268 (= F262), A293 (= A287)
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
34% identity, 84% coverage: 11:273/312 of query aligns to 16:275/294 of 4eumA
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
31% identity, 90% coverage: 31:312/312 of query aligns to 30:300/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ S197), T217 (≠ K228), G219 (= G230), A220 (≠ K231), G222 (= G233), F250 (= F262), N272 (= N284), G275 (≠ A287), A276 (= A288), T279 (= T291)
- binding magnesium ion: D242 (= D254), T244 (= T256), A278 (≠ S290), S287 (≠ P299)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
29% identity, 88% coverage: 31:303/312 of query aligns to 33:301/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (≠ S197), T222 (≠ K228), G224 (= G230), A225 (≠ K231), G227 (= G233), T243 (≠ G247), V246 (= V250), A254 (= A258), G255 (= G259), N282 (vs. gap), A285 (= A287), A286 (= A288), V289 (≠ T291)
- binding alpha-D-ribofuranose: G40 (= G38), K41 (≠ D39), N44 (= N42), A96 (≠ Y94), E141 (≠ L144), D256 (= D260)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS09175 FitnessBrowser__BFirm:BPHYT_RS09175
MTAAPQTGRPEILALGEAMIEFNQSAKDQPNYLQGFGGDTSNFCIAAARQGAQTGFVSAV
GADHFGRLLVDLWEREQVDTSLVRVDPQASTGVYFVSHGPNGHAFDYLRAGSAASRYAPH
DLPLDAIAAAKVIHLSGISLAISLSACDAALEAIAHARANGVRVSFDTNLRLKLWPLARA
RAVMLEAIRQTDICLPSWDDVTDLTGLTGRDEIVDFLLSHGPSVVALKLGKEGSYIATPN
ERRVVPGHVVNAVDATGAGDCFGGAFIARIVAGDDPFTAARYANVAAALSTQGYGAVAPI
PSRATVEQLLAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory