SitesBLAST
Comparing BPHYT_RS09190 FitnessBrowser__BFirm:BPHYT_RS09190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 98% coverage: 8:393/394 of query aligns to 4:394/395 of P06721
- K210 (= K211) modified: N6-(pyridoxal phosphate)lysine
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
37% identity, 98% coverage: 8:393/394 of query aligns to 1:391/392 of 1cl1B
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
37% identity, 97% coverage: 10:393/394 of query aligns to 2:390/391 of 2gqnA
- active site: R54 (≠ L61), Y107 (= Y114), D181 (= D186), K206 (= K211)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), E108 (≠ S115), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), Y334 (≠ W340), S335 (= S341), W336 (= W342), R368 (= R371)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
37% identity, 97% coverage: 10:393/394 of query aligns to 2:390/391 of 2fq6A
- active site: R54 (≠ L61), Y107 (= Y114), D181 (= D186), K206 (= K211)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), P109 (= P116), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), Y334 (≠ W340), S335 (= S341), W336 (= W342), R368 (= R371)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
37% identity, 97% coverage: 10:393/394 of query aligns to 2:390/391 of 1cl2A
- active site: R54 (≠ L61), Y107 (= Y114), D181 (= D186), K206 (= K211)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), Y334 (≠ W340), S335 (= S341), W336 (= W342), R368 (= R371)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
39% identity, 98% coverage: 8:393/394 of query aligns to 1:391/392 of 8sabA
- binding lysine: N9 (≠ R16), R12 (≠ D19), R13 (≠ Q20), K14 (≠ L21), T17 (≠ G24), L330 (= L335), E341 (≠ H346)
- binding pyridoxal-5'-phosphate: C82 (≠ S88), G83 (= G89), A84 (≠ L90), Y108 (= Y114), D182 (= D186), A204 (= A208), T206 (= T210), K207 (= K211), M216 (≠ L220), W337 (= W342)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S88), G83 (= G89), A84 (≠ L90), Y108 (= Y114), D182 (= D186), A204 (= A208), T206 (= T210), K207 (= K211), M216 (≠ L220), Y335 (≠ W340), S336 (= S341), W337 (= W342), R369 (= R371)
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
39% identity, 98% coverage: 8:393/394 of query aligns to 7:397/398 of 8sadA
- binding magnesium ion: A359 (= A355), R362 (= R358), A365 (≠ G361)
- binding pyridoxal-5'-phosphate: C88 (≠ S88), G89 (= G89), A90 (≠ L90), Y114 (= Y114), D188 (= D186), A210 (= A208), T212 (= T210), K213 (= K211), M222 (≠ L220), W343 (= W342)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
39% identity, 97% coverage: 10:393/394 of query aligns to 2:390/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), T205 (= T210), K206 (= K211), M215 (≠ L220), W336 (= W342)
- binding serine: Y107 (= Y114), K206 (= K211), Y334 (≠ W340), S335 (= S341), W336 (= W342), R368 (= R371)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
39% identity, 97% coverage: 10:393/394 of query aligns to 2:390/391 of 8u98A
- binding glycine: Y107 (= Y114), K206 (= K211), Y334 (≠ W340), S335 (= S341), W336 (= W342), R368 (= R371)
- binding pyridoxal-5'-phosphate: Y52 (= Y59), R54 (≠ L61), C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), W336 (= W342)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
39% identity, 97% coverage: 10:393/394 of query aligns to 2:390/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), W336 (= W342)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), S335 (= S341), W336 (= W342), R368 (= R371)
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
37% identity, 97% coverage: 10:393/394 of query aligns to 2:390/391 of 4itxA
- active site: R54 (≠ L61), Y107 (= Y114), D181 (= D186), K206 (= K211)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S88), G82 (= G89), A83 (≠ L90), Y107 (= Y114), D181 (= D186), A203 (= A208), T205 (= T210), K206 (= K211), M215 (≠ L220), Y334 (≠ W340), S335 (= S341), W336 (= W342), R368 (= R371)
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
32% identity, 90% coverage: 38:390/394 of query aligns to 28:385/390 of 8j6nA
- binding [6-methyl-4-[(~{E})-(oxamoylhydrazinylidene)methyl]-5-oxidanyl-pyridin-3-yl]methyl dihydrogen phosphate: Y51 (= Y59), R53 (≠ L61), G81 (= G89), L82 (= L90), Y105 (= Y114), E148 (= E157), N152 (≠ S161), D178 (= D186), S200 (≠ A208), T202 (= T210), K203 (= K211), E330 (≠ W340), S331 (= S341), T346 (= T359), R366 (= R371)
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
33% identity, 85% coverage: 57:390/394 of query aligns to 43:380/381 of 4iyoB
- active site: R47 (≠ L61), Y99 (= Y114), D172 (= D186), K197 (= K211)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y59), R47 (≠ L61)
- binding amino-acrylate: Y99 (= Y114), K197 (= K211), S326 (= S341), T341 (≠ P351), R361 (= R371)
- binding pyruvic acid: Q221 (≠ K234), F224 (≠ A237)
- binding serine: Y45 (= Y59), T48 (≠ H62), Y99 (= Y114), R104 (= R118), N227 (≠ M240), E325 (≠ W340)
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
33% identity, 85% coverage: 57:390/394 of query aligns to 43:380/381 of 4iy7B
- active site: R47 (≠ L61), Y99 (= Y114), D172 (= D186), K197 (= K211)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: Y45 (= Y59), R47 (≠ L61)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: G75 (= G89), M76 (≠ L90), Y99 (= Y114), E143 (= E157), N147 (≠ S161), D172 (= D186), S194 (≠ A208), K197 (= K211), S326 (= S341), L327 (≠ W342), T341 (≠ P351), R361 (= R371)
- binding pyruvic acid: Q221 (≠ K234), F224 (≠ A237)
- binding serine: Y45 (= Y59), T48 (≠ H62), Y99 (= Y114), R104 (= R118), N227 (≠ M240), E325 (≠ W340)
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
33% identity, 85% coverage: 57:390/394 of query aligns to 43:380/381 of 4iy7A
- active site: R47 (≠ L61), Y99 (= Y114), D172 (= D186), K197 (= K211)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: G75 (= G89), M76 (≠ L90), Y99 (= Y114), E143 (= E157), N147 (≠ S161), D172 (= D186), S194 (≠ A208), K197 (= K211), S326 (= S341), L327 (≠ W342), T341 (≠ P351), R361 (= R371)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: Y45 (= Y59), R47 (≠ L61)
- binding serine: Y45 (= Y59), T48 (≠ H62), Y99 (= Y114), R104 (= R118), N227 (≠ M240), E325 (≠ W340)
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
33% identity, 85% coverage: 57:390/394 of query aligns to 43:380/381 of 4ixzA
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
33% identity, 85% coverage: 57:390/394 of query aligns to 43:380/384 of 4iyoD
- active site: R47 (≠ L61), Y99 (= Y114), D172 (= D186), K197 (= K211)
- binding serine: Y45 (= Y59), T48 (≠ H62), Y99 (= Y114), Y99 (= Y114), R104 (= R118), K197 (= K211), N227 (≠ M240), E325 (≠ W340), S326 (= S341), T341 (≠ P351), R361 (= R371)
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
33% identity, 84% coverage: 64:393/394 of query aligns to 41:374/377 of 7ba4A
4ixsB Native structure of xometc at ph 5.2 (see paper)
33% identity, 83% coverage: 64:390/394 of query aligns to 41:371/372 of 4ixsB
Sites not aligning to the query:
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
30% identity, 91% coverage: 31:390/394 of query aligns to 31:394/398 of 1pg8A
- active site: R61 (≠ L61), Y114 (= Y114), D186 (= D186), K211 (= K211)
- binding pyridoxal-5'-phosphate: Y59 (= Y59), R61 (≠ L61), S88 (= S88), G89 (= G89), M90 (≠ L90), Y114 (= Y114), D186 (= D186), S208 (≠ A208), T210 (= T210), K211 (= K211)
Query Sequence
>BPHYT_RS09190 FitnessBrowser__BFirm:BPHYT_RS09190
MTQSKLQRDLQTRIVRAEDQLTPGFESFSMPVTRASTVVFPDLATMRALDWKNDAQWRYG
LHATPTSLALAQRLATIEGGNHALLQPSGLSSISNVYFGLVKAGDDVLIPDNVYSPNRDH
GDWLARDFGITVRYYDPMIGAGMADLIQPNTRLIWLEAPGSVTMEVADVPAITAAARARN
VVTAIDNTWSAGLGFRPFDHGVDISVQALTKYQSGGGDVLMGATITVDRELHLKLKAARM
RMGIGVSSDDCSLILRSLPTMQLRFEQHDRSALGLAKWLKTRPEIAAVLHPALSDCPGHE
FYKRDFTGAGGLFSVVFDGRYSPAQIDTFCESLELFSLGWSWGGAHSLAMPYDVASMRTA
GQWPHSGTLVRFYIGLEAEADLRADMEQSLARLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory